F142688

General Info

Members Datasets Scaffolds Average Seq Length
129 98 258 117

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_1293216|Ga0451843_1293216_72_413
Length 113
Sequence VHRVFAISVASVYPHYVAKVEKKGRTQAELHAVIDWLTGFDGAELRRHLDEGTTFEEFFAQAELTPHTDLIKGVVCGVRVEDVDDPLMQKIRWLDKLVDELAKGKTMEKVLRA

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
50 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
53 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
54 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
55 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
56 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
68 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
69 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
70 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
71 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
72 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
88 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
95 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
96 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
97 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
98 2842677519 Variovorax sp. R-72495 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.6
Nodule 1.55
Rhizoplane 0.78
Rhizosphere 75.97
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_1293216 3300041509 Bacteria 696
2 SwRhRL2b_contig_3068794 2162886007 Bacteria 1071
3 Ga0055524_1001075 3300003775 Bacteria 16780
4 Ga0055536_1003200 3300003781 Bacteria 8876
5 Ga0055540_1005281 3300003792 Bacteria 5495
6 Ga0065704_10097631 3300005289 Bacteria 2385
7 Ga0070658_10034131 3300005327 Bacteria 4093
8 Ga0070658_11139836 3300005327 Bacteria 678
9 Ga0070676_10213271 3300005328 Bacteria 1271
10 Ga0068868_100767108 3300005338 Bacteria 868
11 Ga0070675_100917583 3300005354 Bacteria 803
12 Ga0070688_100508951 3300005365 Bacteria 909
13 Ga0070667_101360407 3300005367 Bacteria 666
14 Ga0070679_100020442 3300005530 Bacteria 6454
15 Ga0070665_100011169 3300005548 Bacteria 9079
16 Ga0070665_100025700 3300005548 Bacteria 5931
17 Ga0075365_10568107 3300006038 Bacteria 802
18 Ga0075365_10964080 3300006038 Bacteria 601
19 Ga0075363_100054442 3300006048 Bacteria 2140
20 Ga0075362_10008479 3300006177 Bacteria 3932
21 Ga0075369_10087954 3300006186 Bacteria 1384
22 Ga0075366_10029903 3300006195 Bacteria 3201
23 Ga0075366_10091722 3300006195 Bacteria 1820
24 Ga0075366_10323342 3300006195 Bacteria 945
25 Ga0075366_11073879 3300006195 Bacteria 503
26 Ga0068871_100000696 3300006358 Bacteria 22824
27 Ga0068871_100084171 3300006358 Bacteria 2639
28 Ga0099826_10000001 3300006948 Bacteria 1155201
29 Ga0105240_10151523 3300009093 Bacteria 2761
30 Ga0105245_10259390 3300009098 Bacteria 1691
31 Ga0105245_12399115 3300009098 Bacteria 581
32 Ga0105243_10000015 3300009148 Bacteria 251115
33 Ga0105242_10000028 3300009176 Bacteria 106293
34 Ga0105248_10760662 3300009177 Bacteria 1093
35 Ga0157370_10006035 3300013104 Bacteria 13470
36 Ga0157369_12333746 3300013105 Bacteria 542
37 Ga0157376_10459175 3300014969 Bacteria 1244
38 Ga0157376_11230662 3300014969 Bacteria 777
39 Ga0163161_10000042 3300017792 Bacteria 135368
40 Ga0209676_1000024 3300025292 Bacteria 578839
41 Ga0209564_1050885 3300025295 Bacteria 1010
42 Ga0209256_1000005 3300025299 Bacteria 1315082
43 Ga0209051_1000370 3300025303 Bacteria 64642
44 Ga0207645_10886118 3300025907 Bacteria 606
45 Ga0207705_10066697 3300025909 Bacteria 2603
46 Ga0207649_11087030 3300025920 Bacteria 631
47 Ga0207652_10053858 3300025921 Bacteria 3456
48 Ga0207659_10799058 3300025926 Bacteria 810
49 Ga0207686_10000031 3300025934 Bacteria 158735
50 Ga0207709_10000009 3300025935 Bacteria 619238
51 Ga0207709_11199052 3300025935 Bacteria 625
52 Ga0207669_10244226 3300025937 Bacteria 1333
53 Ga0207689_10973273 3300025942 Bacteria 716
54 Ga0207676_10200090 3300026095 Bacteria 1764
55 Ga0207676_10369036 3300026095 Bacteria 1333
56 Ga0207674_11446324 3300026116 Bacteria 657
57 Ga0207674_11978060 3300026116 Bacteria 548
58 Ga0207683_10216715 3300026121 Bacteria 1744
59 Ga0207683_10482117 3300026121 Unclassified 1144
60 Ga0209282_1000001 3300027666 Bacteria 2450367
61 Ga0268266_10040941 3300028379 Bacteria 3950
62 Ga0268266_10052020 3300028379 Bacteria 3516
63 Ga0268266_10059571 3300028379 Bacteria 3290
64 Ga0316177_1187728 3300030731 Bacteria 3326
65 Ga0316176_1109767 3300030732 Bacteria 1189
66 Ga0314311_1066507 3300030733 Bacteria 4329
67 Ga0316178_1149316 3300030735 Bacteria 1321
68 Ga0316180_1018719 3300030736 Bacteria 1804
69 Ga0316183_1037942 3300030742 Bacteria 6602
70 Ga0316183_1150429 3300030742 Bacteria 1221
71 Ga0316181_1164000 3300030744 Bacteria 1589
72 Ga0316181_1293883 3300030744 Bacteria 1413
73 Ga0316182_1165664 3300030745 Bacteria 4688
74 Ga0316182_1282407 3300030745 Bacteria 2026
75 Ga0307408_100258249 3300031548 Bacteria 1440
76 Ga0307408_100394596 3300031548 Bacteria 1186
77 Ga0307408_102444041 3300031548 Bacteria 508
78 Ga0307508_10778970 3300031616 Bacteria 572
79 Ga0316576_10671614 3300031727 Bacteria 752
80 Ga0307405_10136675 3300031731 Bacteria 1702
81 Ga0307406_10007564 3300031901 Bacteria 6030
82 Ga0307406_10143199 3300031901 Bacteria 1695
83 Ga0307412_10085299 3300031911 Bacteria 2194
84 Ga0307416_100219955 3300032002 Bacteria 1820
85 Ga0307416_100968741 3300032002 Bacteria 953
86 Ga0307414_10029957 3300032004 Bacteria 3549
87 Ga0307414_10078407 3300032004 Bacteria 2408
88 Ga0307414_10274849 3300032004 Bacteria 1413
89 Ga0307414_10549018 3300032004 Bacteria 1029
90 Ga0307411_10056574 3300032005 Bacteria 2586
91 Ga0307411_10157791 3300032005 Bacteria 1695
92 Ga0307411_10706322 3300032005 Bacteria 879
93 Ga0307415_101088481 3300032126 Bacteria 748
94 Ga0439439_0209835 3300041406 Bacteria 568
95 Ga0439465_0092814 3300041413 Bacteria 1035
96 Ga0451791_1027913 3300041451 Bacteria 664
97 Ga0439449_0015113 3300042007 Bacteria 2901
98 Ga0439449_0094303 3300042007 Bacteria 1105
99 Ga0450912_015612 3300042116 Bacteria 697
100 Ga0439459_0155479 3300042438 Bacteria 600
101 Ga0453684_1300281 3300044712 Bacteria 759
102 Ga0495583_0432660 3300046506 Bacteria 516
103 Ga0495606_0002705 3300046507 Bacteria 20011
104 Ga0495610_0012539 3300046512 Bacteria 5094
105 Ga0495586_0507300 3300046535 Bacteria 696
106 Ga0495636_0094174 3300047318 Bacteria 1303
107 Ga0495685_263303 3300047447 Unclassified 545
108 Ga0496126_0042440 3300048929 Bacteria 4201
109 Ga0501032_0211364 3300049569 Bacteria 1264
110 Ga0501034_0002433 3300049571 Bacteria 22486
111 Ga0501034_0033062 3300049571 Bacteria 5251
112 Ga0501037_0065458 3300049573 Bacteria 2648
113 Ga0501047_0017500 3300049581 Bacteria 6865
114 Ga0501072_0003855 3300049588 Bacteria 11335
115 Ga0501075_1355333 3300049591 Bacteria 539
116 Ga0501249_041845 3300049679 Bacteria 1040
117 Ga0501225_0001868 3300049705 Bacteria 6612
118 Ga0501035_0001017 3300049822 Bacteria 29541
119 Ga0501044_0004920 3300049823 Bacteria 14935
120 nmdc:mga03683_425164_c1 3300050489 Bacteria 637
121 nmdc:mga0yw44_360901_c1 3300050492 Bacteria 979
122 nmdc:mga0yw44_453277_c1 3300050492 Bacteria 869
123 nmdc:mga0k408_122125_c1 3300050493 Bacteria 1543
124 nmdc:mga0k408_15664_c2 3300050493 Bacteria 2882
125 Ga0500635_0239742 3300053080 Unclassified 710
126 Ga0500556_0000218 3300053104 Bacteria 46755
127 Ga0500573_0000121 3300053140 Bacteria 30931
128 Ga0590071_115411 3300059421 Unclassified 683
129 2842680965 2842677519 Bacteria 5615038
130 Ga0451843_1293216
131 SwRhRL2b_contig_3068794
132 Ga0055524_1001075
133 Ga0055536_1003200
134 Ga0055540_1005281
135 Ga0065704_10097631
136 Ga0070658_10034131
137 Ga0070658_11139836
138 Ga0070676_10213271
139 Ga0068868_100767108
140 Ga0070675_100917583
141 Ga0070688_100508951
142 Ga0070667_101360407
143 Ga0070679_100020442
144 Ga0070665_100011169
145 Ga0070665_100025700
146 Ga0075365_10568107
147 Ga0075365_10964080
148 Ga0075363_100054442
149 Ga0075362_10008479
150 Ga0075369_10087954
151 Ga0075366_10029903
152 Ga0075366_10091722
153 Ga0075366_10323342
154 Ga0075366_11073879
155 Ga0068871_100000696
156 Ga0068871_100084171
157 Ga0099826_10000001
158 Ga0105240_10151523
159 Ga0105245_10259390
160 Ga0105245_12399115
161 Ga0105243_10000015
162 Ga0105242_10000028
163 Ga0105248_10760662
164 Ga0157370_10006035
165 Ga0157369_12333746
166 Ga0157376_10459175
167 Ga0157376_11230662
168 Ga0163161_10000042
169 Ga0209676_1000024
170 Ga0209564_1050885
171 Ga0209256_1000005
172 Ga0209051_1000370
173 Ga0207645_10886118
174 Ga0207705_10066697
175 Ga0207649_11087030
176 Ga0207652_10053858
177 Ga0207659_10799058
178 Ga0207686_10000031
179 Ga0207709_10000009
180 Ga0207709_11199052
181 Ga0207669_10244226
182 Ga0207689_10973273
183 Ga0207676_10200090
184 Ga0207676_10369036
185 Ga0207674_11446324
186 Ga0207674_11978060
187 Ga0207683_10216715
188 Ga0207683_10482117
189 Ga0209282_1000001
190 Ga0268266_10040941
191 Ga0268266_10052020
192 Ga0268266_10059571
193 Ga0316177_1187728
194 Ga0316176_1109767
195 Ga0314311_1066507
196 Ga0316178_1149316
197 Ga0316180_1018719
198 Ga0316183_1037942
199 Ga0316183_1150429
200 Ga0316181_1164000
201 Ga0316181_1293883
202 Ga0316182_1165664
203 Ga0316182_1282407
204 Ga0307408_100258249
205 Ga0307408_100394596
206 Ga0307408_102444041
207 Ga0307508_10778970
208 Ga0316576_10671614
209 Ga0307405_10136675
210 Ga0307406_10007564
211 Ga0307406_10143199
212 Ga0307412_10085299
213 Ga0307416_100219955
214 Ga0307416_100968741
215 Ga0307414_10029957
216 Ga0307414_10078407
217 Ga0307414_10274849
218 Ga0307414_10549018
219 Ga0307411_10056574
220 Ga0307411_10157791
221 Ga0307411_10706322
222 Ga0307415_101088481
223 Ga0439439_0209835
224 Ga0439465_0092814
225 Ga0451791_1027913
226 Ga0439449_0015113
227 Ga0439449_0094303
228 Ga0450912_015612
229 Ga0439459_0155479
230 Ga0453684_1300281
231 Ga0495583_0432660
232 Ga0495606_0002705
233 Ga0495610_0012539
234 Ga0495586_0507300
235 Ga0495636_0094174
236 Ga0495685_263303
237 Ga0496126_0042440
238 Ga0501032_0211364
239 Ga0501034_0002433
240 Ga0501034_0033062
241 Ga0501037_0065458
242 Ga0501047_0017500
243 Ga0501072_0003855
244 Ga0501075_1355333
245 Ga0501249_041845
246 Ga0501225_0001868
247 Ga0501035_0001017
248 Ga0501044_0004920
249 nmdc:mga03683_425164_c1
250 nmdc:mga0yw44_360901_c1
251 nmdc:mga0yw44_453277_c1
252 nmdc:mga0k408_122125_c1
253 nmdc:mga0k408_15664_c2
254 Ga0500635_0239742
255 Ga0500556_0000218
256 Ga0500573_0000121
257 Ga0590071_115411
258 2842680965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

3

112

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9259 1 116
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.8883 1 116
5cd4-assembly1.cif.gz_C the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.4452 10 115
8cq4-assembly1.cif.gz_A bifunctional cyclohexadienyl dehydratase/chorismate mutase from janthinobacterium sp. hh01 0.4103 14 109
8cq6-assembly1.cif.gz_D bifunctional cyclohexadienyl dehydratase/chorismate mutase from duganella sacchari 0.4085 14 109
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9379 9 116 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8545 9 116 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7983 11 116 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7825 11 116 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.733 11 116 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A6B3C8S0-F1-model_v4 DUF2200 domain-containing protein 1.001 3 107
AF-A0A1H0EDN8-F1-model_v4 DUF2200 domain-containing protein 0.9978 3 97
AF-A0A849BP65-F1-model_v4 DUF2200 domain-containing protein 0.9975 3 117
AF-A0A4S5JJT5-F1-model_v4 DUF2200 domain-containing protein 0.9972 3 114
AF-A0A3A5WPL9-F1-model_v4 DUF2200 domain-containing protein 0.9971 3 109

Map