F141617

General Info

Members Datasets Scaffolds Average Seq Length
129 82 129 87

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10836011|Ga0114129_108360112
Length 106
Sequence MLAPSLTLANVMLITVVIWRMAVAHSKLTAQGQISVPASIRRRLGVGPGSVLEWDDDGQNIVVRRAGRYSSEDVHRAVFRTPPKPRTLADLKDGVRRDVKRRRAIR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
63 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
68 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
69 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
70 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
71 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
74 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
79 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
80 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 0
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100413647 3300005329 Bacteria 1286
2 Ga0070682_100032521 3300005337 Bacteria 3164
3 Ga0070692_10754462 3300005345 Unclassified 660
4 Ga0070674_101594935 3300005356 Bacteria 588
5 Ga0070703_10391373 3300005406 Unclassified 603
6 Ga0070694_100011838 3300005444 Bacteria 5410
7 Ga0070694_100030394 3300005444 Bacteria 3533
8 Ga0070694_101939593 3300005444 Unclassified 503
9 Ga0070663_101887630 3300005455 Unclassified 536
10 Ga0070681_10276375 3300005458 Bacteria 1591
11 Ga0070707_100862132 3300005468 Bacteria 870
12 Ga0070707_101413609 3300005468 Unclassified 662
13 Ga0070698_100072047 3300005471 Bacteria 3463
14 Ga0070698_100094578 3300005471 Bacteria 2967
15 Ga0070698_102202789 3300005471 Unclassified 505
16 Ga0070699_100180333 3300005518 Unclassified 1874
17 Ga0070699_100350974 3300005518 Bacteria 1329
18 Ga0070699_100755331 3300005518 Unclassified 889
19 Ga0070697_101013544 3300005536 Bacteria 738
20 Ga0070695_100313062 3300005545 Bacteria 1164
21 Ga0070695_100430424 3300005545 Bacteria 1007
22 Ga0070696_100107332 3300005546 Bacteria 2008
23 Ga0070696_100111017 3300005546 Unclassified 1975
24 Ga0070704_100001834 3300005549 Bacteria 11706
25 Ga0070704_100467577 3300005549 Bacteria 1089
26 Ga0068855_102057342 3300005563 Unclassified 576
27 Ga0068859_100812467 3300005617 Unclassified 1022
28 Ga0068866_10980710 3300005718 Unclassified 599
29 Ga0068861_100929500 3300005719 Unclassified 826
30 Ga0068861_102593640 3300005719 Bacteria 511
31 Ga0068858_100001722 3300005842 Bacteria 22354
32 Ga0068862_100241623 3300005844 Bacteria 1642
33 Ga0081455_10447538 3300005937 Unclassified 883
34 Ga0081539_10102331 3300005985 Bacteria 1457
35 Ga0070717_10155183 3300006028 Unclassified 1983
36 Ga0075366_10292918 3300006195 Unclassified 995
37 Ga0097621_100323649 3300006237 Bacteria 1366
38 Ga0075428_101245621 3300006844 Bacteria 783
39 Ga0075428_102657321 3300006844 Unclassified 511
40 Ga0075433_10002723 3300006852 Bacteria 13504
41 Ga0075433_10082176 3300006852 Bacteria 2841
42 Ga0075433_10444438 3300006852 Unclassified 1143
43 Ga0075434_100001254 3300006871 Bacteria 21144
44 Ga0075434_100030335 3300006871 Bacteria 5324
45 Ga0075429_100610415 3300006880 Unclassified 956
46 Ga0075429_101284703 3300006880 Unclassified 638
47 Ga0097620_100812571 3300006931 Unclassified 1022
48 Ga0075435_100005836 3300007076 Bacteria 8660
49 Ga0075435_100048900 3300007076 Bacteria 3399
50 Ga0105240_11280340 3300009093 Bacteria 774
51 Ga0111539_10009320 3300009094 Bacteria 12399
52 Ga0111539_10114144 3300009094 Bacteria 3168
53 Ga0111539_13302754 3300009094 Unclassified 519
54 Ga0105245_10000163 3300009098 Bacteria 62999
55 Ga0114129_10107972 3300009147 Bacteria 3843
56 Ga0114129_10169607 3300009147 Unclassified 2976
57 Ga0114129_10209378 3300009147 Unclassified 2637
58 Ga0114129_10229957 3300009147 Bacteria 2498
59 Ga0114129_10503320 3300009147 Unclassified 1582
60 Ga0114129_10640180 3300009147 Bacteria 1373
61 Ga0114129_10834941 3300009147 Bacteria 1173
62 Ga0114129_10836011 3300009147 Unclassified 1172
63 Ga0105242_11089095 3300009176 Bacteria 812
64 Ga0105248_10018219 3300009177 Bacteria 7756
65 Ga0105237_10355663 3300009545 Bacteria 1469
66 Ga0105238_10818883 3300009551 Bacteria 947
67 Ga0157371_10366159 3300013102 Unclassified 1051
68 Ga0157372_10037112 3300013307 Bacteria 5372
69 Ga0207695_10844163 3300025913 Bacteria 796
70 Ga0207669_11048463 3300025937 Bacteria 687
71 Ga0207711_10170892 3300025941 Unclassified 1972
72 Ga0207712_11471138 3300025961 Unclassified 610
73 Ga0207703_10000069 3300026035 Bacteria 124592
74 Ga0207708_10744868 3300026075 Unclassified 840
75 Ga0207702_10578909 3300026078 Bacteria 1100
76 Ga0207674_11154652 3300026116 Bacteria 744
77 Ga0207674_11459543 3300026116 Unclassified 653
78 Ga0209968_1111300 3300027526 Unclassified 502
79 Ga0209974_10301564 3300027876 Unclassified 613
80 Ga0207428_10036899 3300027907 Bacteria 3981
81 Ga0268265_10787327 3300028380 Unclassified 926
82 Ga0268265_12066817 3300028380 Unclassified 577
83 Ga0307515_10521227 3300028794 Unclassified 798
84 Ga0307511_10023015 3300030521 Bacteria 5822
85 Ga0307511_10026388 3300030521 Bacteria 5329
86 Ga0373933_1028188 3300035724 Unclassified 543
87 Ga0373937_1424240 3300036401 Bacteria 641
88 Ga0453683_0557215 3300044673 Unclassified 746
89 Ga0451576_0832875 3300045051 Unclassified 969
90 Ga0495643_0007036 3300046522 Bacteria 7309
91 Ga0495621_0227952 3300046539 Unclassified 756
92 Ga0495646_0331356 3300046680 Bacteria 800
93 Ga0501036_0413270 3300049572 Unclassified 1125
94 Ga0501042_0065033 3300049578 Unclassified 2607
95 Ga0501046_0458757 3300049580 Bacteria 916
96 Ga0501069_0860704 3300049585 Unclassified 551
97 Ga0501071_0242779 3300049587 Unclassified 1358
98 Ga0501071_0812802 3300049587 Bacteria 721
99 Ga0501075_0741629 3300049591 Unclassified 748
100 Ga0501076_0113061 3300049592 Unclassified 2196
101 Ga0501076_0156253 3300049592 Bacteria 1857
102 Ga0501076_0386275 3300049592 Unclassified 1151
103 Ga0501079_0659265 3300049741 Unclassified 824
104 Ga0501080_0385235 3300049742 Unclassified 1263
105 Ga0501045_0292454 3300049824 Bacteria 1212
106 nmdc:mga0k408_358423_c1 3300050493 Bacteria 869
107 nmdc:mga05p37_1617164_c1 3300050507 Bacteria 637
108 nmdc:mga05p37_1640414_c1 3300050507 Unclassified 631
109 nmdc:mga05p37_172537_c1 3300050507 Unclassified 2637
110 nmdc:mga05p37_174223_c1 3300050507 Bacteria 2622
111 nmdc:mga05p37_18784_c1 3300050507 Bacteria 8354
112 nmdc:mga05p37_238904_c1 3300050507 Bacteria 2186
113 nmdc:mga05p37_290112_c1 3300050507 Unclassified 1948
114 nmdc:mga05p37_506769_c1 3300050507 Bacteria 1384
115 nmdc:mga09592_1698101_c1 3300050508 Unclassified 509
116 nmdc:mga09592_438760_c1 3300050508 Bacteria 1127
117 nmdc:mga08y16_6028_c1 3300050511 Bacteria 12705
118 nmdc:mga08y16_684924_c1 3300050511 Bacteria 1026
119 nmdc:mga08y16_71428_c1 3300050511 Bacteria 3617
120 nmdc:mga0n895_17581_c1 3300050512 Bacteria 6595
121 nmdc:mga0n895_20201_c1 3300050512 Bacteria 6207
122 nmdc:mga0rr50_1028_c1 3300050513 Bacteria 15140
123 nmdc:mga0rr50_42974_c1 3300050513 Bacteria 3303
124 nmdc:mga0rr50_917279_c1 3300050513 Bacteria 747
125 nmdc:mga08x19_1005315_c1 3300050514 Bacteria 592
126 nmdc:mga0a205_1454257_c1 3300050515 Bacteria 533
127 nmdc:mga0a205_410_c2 3300050515 Bacteria 27270
128 Ga0501084_0754143 3300054114 Bacteria 820
129 Ga0501084_0831794 3300054114 Bacteria 777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_1028188 Ga0373933_1028188_265_528 85
2 3300005329 Ga0070683_100413647 Ga0070683_1004136473 86
3 3300005337 Ga0070682_100032521 Ga0070682_1000325214 86
4 3300005345 Ga0070692_10754462 Ga0070692_107544622 86
5 3300005356 Ga0070674_101594935 Ga0070674_1015949351 86
6 3300005406 Ga0070703_10391373 Ga0070703_103913731 86
7 3300005444 Ga0070694_100011838 Ga0070694_1000118387 86
8 3300005444 Ga0070694_100030394 Ga0070694_1000303943 86
9 3300005444 Ga0070694_101939593 Ga0070694_1019395932 86
10 3300005455 Ga0070663_101887630 Ga0070663_1018876302 86
11 3300005458 Ga0070681_10276375 Ga0070681_102763751 86
12 3300005468 Ga0070707_100862132 Ga0070707_1008621321 86
13 3300005468 Ga0070707_101413609 Ga0070707_1014136092 86
14 3300005471 Ga0070698_100072047 Ga0070698_1000720472 86
15 3300005471 Ga0070698_100094578 Ga0070698_1000945783 86
16 3300005471 Ga0070698_102202789 Ga0070698_1022027892 86
17 3300005518 Ga0070699_100180333 Ga0070699_1001803332 86
18 3300005518 Ga0070699_100350974 Ga0070699_1003509741 86
19 3300005518 Ga0070699_100755331 Ga0070699_1007553312 86
20 3300005536 Ga0070697_101013544 Ga0070697_1010135442 86
21 3300005545 Ga0070695_100313062 Ga0070695_1003130622 86
22 3300005545 Ga0070695_100430424 Ga0070695_1004304243 86
23 3300005546 Ga0070696_100107332 Ga0070696_1001073323 86
24 3300005546 Ga0070696_100111017 Ga0070696_1001110172 86
25 3300005549 Ga0070704_100001834 Ga0070704_10000183413 86
26 3300005549 Ga0070704_100467577 Ga0070704_1004675772 86
27 3300005563 Ga0068855_102057342 Ga0068855_1020573421 86
28 3300005617 Ga0068859_100812467 Ga0068859_1008124671 86
29 3300005718 Ga0068866_10980710 Ga0068866_109807102 86
30 3300005719 Ga0068861_100929500 Ga0068861_1009295002 86
31 3300005719 Ga0068861_102593640 Ga0068861_1025936402 86
32 3300005842 Ga0068858_100001722 Ga0068858_1000017229 86
33 3300005844 Ga0068862_100241623 Ga0068862_1002416232 86
34 3300005937 Ga0081455_10447538 Ga0081455_104475382 86
35 3300005985 Ga0081539_10102331 Ga0081539_101023313 86
36 3300006028 Ga0070717_10155183 Ga0070717_101551832 86
37 3300006195 Ga0075366_10292918 Ga0075366_102929182 86
38 3300006237 Ga0097621_100323649 Ga0097621_1003236493 86
39 3300006844 Ga0075428_101245621 Ga0075428_1012456212 86
40 3300006844 Ga0075428_102657321 Ga0075428_1026573212 86
41 3300006852 Ga0075433_10002723 Ga0075433_100027233 86
42 3300006852 Ga0075433_10082176 Ga0075433_100821763 86
43 3300006852 Ga0075433_10444438 Ga0075433_104444383 86
44 3300006871 Ga0075434_100001254 Ga0075434_1000012545 86
45 3300006871 Ga0075434_100030335 Ga0075434_1000303355 86
46 3300006880 Ga0075429_100610415 Ga0075429_1006104151 86
47 3300006880 Ga0075429_101284703 Ga0075429_1012847032 86
48 3300006931 Ga0097620_100812571 Ga0097620_1008125713 86
49 3300007076 Ga0075435_100005836 Ga0075435_1000058364 86
50 3300007076 Ga0075435_100048900 Ga0075435_1000489003 86
51 3300009093 Ga0105240_11280340 Ga0105240_112803402 86
52 3300009094 Ga0111539_10009320 Ga0111539_1000932012 86
53 3300009094 Ga0111539_10114144 Ga0111539_101141442 86
54 3300009094 Ga0111539_13302754 Ga0111539_133027541 86
55 3300009098 Ga0105245_10000163 Ga0105245_1000016335 86
56 3300009147 Ga0114129_10107972 Ga0114129_101079727 86
57 3300009147 Ga0114129_10169607 Ga0114129_101696074 86
58 3300009147 Ga0114129_10209378 Ga0114129_102093782 86
59 3300009147 Ga0114129_10229957 Ga0114129_102299573 86
60 3300009147 Ga0114129_10503320 Ga0114129_105033202 86
61 3300009147 Ga0114129_10640180 Ga0114129_106401802 86
62 3300009147 Ga0114129_10834941 Ga0114129_108349411 86
63 3300009147 Ga0114129_10836011 Ga0114129_108360112 86
64 3300009176 Ga0105242_11089095 Ga0105242_110890952 86
65 3300009177 Ga0105248_10018219 Ga0105248_100182193 86
66 3300009545 Ga0105237_10355663 Ga0105237_103556631 86
67 3300009551 Ga0105238_10818883 Ga0105238_108188833 86
68 3300013102 Ga0157371_10366159 Ga0157371_103661591 86
69 3300013307 Ga0157372_10037112 Ga0157372_100371124 86
70 3300025913 Ga0207695_10844163 Ga0207695_108441632 86
71 3300025937 Ga0207669_11048463 Ga0207669_110484632 86
72 3300025941 Ga0207711_10170892 Ga0207711_101708922 86
73 3300025961 Ga0207712_11471138 Ga0207712_114711382 86
74 3300026035 Ga0207703_10000069 Ga0207703_1000006924 86
75 3300026075 Ga0207708_10744868 Ga0207708_107448682 86
76 3300026078 Ga0207702_10578909 Ga0207702_105789092 86
77 3300026116 Ga0207674_11154652 Ga0207674_111546522 86
78 3300026116 Ga0207674_11459543 Ga0207674_114595432 86
79 3300027526 Ga0209968_1111300 Ga0209968_11113002 86
80 3300027876 Ga0209974_10301564 Ga0209974_103015642 86
81 3300027907 Ga0207428_10036899 Ga0207428_100368995 86
82 3300028380 Ga0268265_10787327 Ga0268265_107873272 86
83 3300028380 Ga0268265_12066817 Ga0268265_120668172 86
84 3300028794 Ga0307515_10521227 Ga0307515_105212272 86
85 3300030521 Ga0307511_10023015 Ga0307511_100230156 86
86 3300030521 Ga0307511_10026388 Ga0307511_100263886 86
87 3300036401 Ga0373937_1424240 Ga0373937_1424240_232_492 86
88 3300044673 Ga0453683_0557215 Ga0453683_0557215_271_534 86
89 3300045051 Ga0451576_0832875 Ga0451576_0832875_82_345 86
90 3300046522 Ga0495643_0007036 Ga0495643_0007036_1135_1395 86
91 3300046539 Ga0495621_0227952 Ga0495621_0227952_81_341 86
92 3300046680 Ga0495646_0331356 Ga0495646_0331356_312_584 86
93 3300049572 Ga0501036_0413270 Ga0501036_0413270_241_501 86
94 3300049578 Ga0501042_0065033 Ga0501042_0065033_1073_1333 86
95 3300049580 Ga0501046_0458757 Ga0501046_0458757_181_444 86
96 3300049585 Ga0501069_0860704 Ga0501069_0860704_172_432 86
97 3300049587 Ga0501071_0242779 Ga0501071_0242779_30_290 86
98 3300049587 Ga0501071_0812802 Ga0501071_0812802_383_646 86
99 3300049591 Ga0501075_0741629 Ga0501075_0741629_181_441 86
100 3300049592 Ga0501076_0113061 Ga0501076_0113061_385_645 86
101 3300049592 Ga0501076_0156253 Ga0501076_0156253_1076_1339 86
102 3300049592 Ga0501076_0386275 Ga0501076_0386275_580_840 86
103 3300049741 Ga0501079_0659265 Ga0501079_0659265_522_782 86
104 3300049742 Ga0501080_0385235 Ga0501080_0385235_824_1084 86
105 3300049824 Ga0501045_0292454 Ga0501045_0292454_266_529 86
106 3300050493 nmdc:mga0k408_358423_c1 nmdc:mga0k408_358423_c1_140_400 86
107 3300050507 nmdc:mga05p37_1617164_c1 nmdc:mga05p37_1617164_c1_264_524 86
108 3300050507 nmdc:mga05p37_1640414_c1 nmdc:mga05p37_1640414_c1_353_613 86
109 3300050507 nmdc:mga05p37_172537_c1 nmdc:mga05p37_172537_c1_2221_2481 86
110 3300050507 nmdc:mga05p37_174223_c1 nmdc:mga05p37_174223_c1_251_571 86
111 3300050507 nmdc:mga05p37_18784_c1 nmdc:mga05p37_18784_c1_590_850 86
112 3300050507 nmdc:mga05p37_238904_c1 nmdc:mga05p37_238904_c1_1559_1819 86
113 3300050507 nmdc:mga05p37_290112_c1 nmdc:mga05p37_290112_c1_275_544 86
114 3300050507 nmdc:mga05p37_506769_c1 nmdc:mga05p37_506769_c1_559_819 86
115 3300050508 nmdc:mga09592_1698101_c1 nmdc:mga09592_1698101_c1_141_401 86
116 3300050508 nmdc:mga09592_438760_c1 nmdc:mga09592_438760_c1_610_870 86
117 3300050511 nmdc:mga08y16_6028_c1 nmdc:mga08y16_6028_c1_2078_2338 86
118 3300050511 nmdc:mga08y16_684924_c1 nmdc:mga08y16_684924_c1_145_405 86
119 3300050511 nmdc:mga08y16_71428_c1 nmdc:mga08y16_71428_c1_3311_3574 86
120 3300050512 nmdc:mga0n895_17581_c1 nmdc:mga0n895_17581_c1_3554_3814 86
121 3300050512 nmdc:mga0n895_20201_c1 nmdc:mga0n895_20201_c1_3236_3496 86
122 3300050513 nmdc:mga0rr50_1028_c1 nmdc:mga0rr50_1028_c1_2091_2351 86
123 3300050513 nmdc:mga0rr50_42974_c1 nmdc:mga0rr50_42974_c1_1730_1990 86
124 3300050513 nmdc:mga0rr50_917279_c1 nmdc:mga0rr50_917279_c1_32_301 86
125 3300050514 nmdc:mga08x19_1005315_c1 nmdc:mga08x19_1005315_c1_246_506 86
126 3300050515 nmdc:mga0a205_1454257_c1 nmdc:mga0a205_1454257_c1_107_376 86
127 3300050515 nmdc:mga0a205_410_c2 nmdc:mga0a205_410_c2_20179_20439 86
128 3300054114 Ga0501084_0754143 Ga0501084_0754143_233_493 86
129 3300054114 Ga0501084_0831794 Ga0501084_0831794_308_571 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

26

70

0.83

Feature Viewer

pLDDT pTM Quality
64.42 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map