F141306

General Info

Members Datasets Scaffolds Average Seq Length
129 101 258 167

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100450413|Ga0075363_1004504131
Length 163
Sequence MSVYDIPIAGLEGQPDLLAEQKGKVSLIVNVASRCGLTPQYEGLVKLHAQYADRGFSVVGVPCNQFLGQEPGTAEEIKSFCSTTYGVDFPLSEKIEVNGDDRHPLYETLTAVDYSSGKPAGDITWNFEKFLVSSDGEVIGRFRPQTEPDDERIATLIEQNLPA

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
88 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
98 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
99 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
100 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
101 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 3.1
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100450413 3300006048 Bacteria 760
2 Ga0070690_100315588 3300005330 Bacteria 1125
3 Ga0070668_100000103 3300005347 Bacteria 52127
4 Ga0070668_100892868 3300005347 Bacteria 794
5 Ga0070669_100058435 3300005353 Bacteria 2830
6 Ga0070714_101336131 3300005435 Bacteria 700
7 Ga0070700_100000179 3300005441 Bacteria 35841
8 Ga0070684_100060329 3300005535 Bacteria 3317
9 Ga0070665_100700103 3300005548 Bacteria 1026
10 Ga0068855_100118251 3300005563 Bacteria 3036
11 Ga0068859_100413387 3300005617 Bacteria 1445
12 Ga0068870_10725444 3300005840 Bacteria 688
13 Ga0068862_100019999 3300005844 Bacteria 5589
14 Ga0068862_100744365 3300005844 Bacteria 953
15 Ga0081455_10266030 3300005937 Bacteria 1246
16 Ga0075368_10094740 3300006042 Bacteria 1223
17 Ga0075428_100019076 3300006844 Bacteria 7584
18 Ga0075428_100071379 3300006844 Bacteria 3795
19 Ga0075428_100289524 3300006844 Bacteria 1762
20 Ga0075430_100000769 3300006846 Bacteria 24735
21 Ga0075430_100028584 3300006846 Bacteria 4735
22 Ga0075430_100364137 3300006846 Bacteria 1194
23 Ga0075431_100000917 3300006847 Bacteria 25947
24 Ga0075431_100454339 3300006847 Bacteria 1276
25 Ga0075429_100002580 3300006880 Bacteria 15275
26 Ga0075429_100053204 3300006880 Bacteria 3523
27 Ga0075429_100159496 3300006880 Bacteria 1975
28 Ga0097620_100413425 3300006931 Bacteria 1445
29 Ga0105250_10252184 3300009092 Bacteria 754
30 Ga0105240_10016149 3300009093 Bacteria 10119
31 Ga0111539_10006677 3300009094 Bacteria 14860
32 Ga0111539_10602989 3300009094 Bacteria 1279
33 Ga0105245_11261264 3300009098 Bacteria 787
34 Ga0114129_10064737 3300009147 Bacteria 5102
35 Ga0114129_10070593 3300009147 Bacteria 4871
36 Ga0114129_10410927 3300009147 Bacteria 1782
37 Ga0105248_10034462 3300009177 Bacteria 5661
38 Ga0105237_11796962 3300009545 Bacteria 621
39 Ga0105238_11466204 3300009551 Bacteria 710
40 Ga0157378_10269825 3300013297 Bacteria 1636
41 Ga0163162_11023875 3300013306 Bacteria 934
42 Ga0213872_10001537 3300021361 Bacteria 14827
43 Ga0213872_10019760 3300021361 Bacteria 3102
44 Ga0207696_1114531 3300025711 Bacteria 729
45 Ga0207684_10294220 3300025910 Bacteria 1400
46 Ga0207695_10052451 3300025913 Bacteria 4273
47 Ga0207681_10138057 3300025923 Bacteria 1812
48 Ga0207711_10049734 3300025941 Bacteria 3589
49 Ga0207689_11379453 3300025942 Bacteria 591
50 Ga0207661_10003585 3300025944 Bacteria 10800
51 Ga0207668_10406923 3300025972 Bacteria 1152
52 Ga0207658_10101161 3300025986 Bacteria 2258
53 Ga0207708_10000036 3300026075 Bacteria 138158
54 Ga0209813_10095698 3300027866 Bacteria 1003
55 Ga0207428_10168099 3300027907 Bacteria 1662
56 Ga0268266_10724732 3300028379 Bacteria 959
57 Ga0268265_10040456 3300028380 Bacteria 3443
58 Ga0265325_10222662 3300031241 Bacteria 863
59 Ga0265316_10140592 3300031344 Bacteria 1813
60 Ga0307509_10109710 3300031507 Bacteria 2768
61 Ga0265313_10051712 3300031595 Bacteria 1965
62 Ga0307508_10061982 3300031616 Bacteria 3302
63 Ga0265314_10343237 3300031711 Bacteria 824
64 Ga0307518_10215743 3300031838 Bacteria 1258
65 Ga0307406_10480451 3300031901 Bacteria 1003
66 Ga0307409_100246381 3300031995 Bacteria 1631
67 Ga0307409_102180221 3300031995 Bacteria 584
68 Ga0307416_101762761 3300032002 Bacteria 723
69 Ga0316574_0203908 3300035398 Bacteria 1270
70 Ga0316574_0778797 3300035398 Bacteria 583
71 Ga0373927_0082884 3300035695 Bacteria 2079
72 Ga0373925_0047144 3300037068 Bacteria 3207
73 Ga0395905_0660720 3300037471 Bacteria 947
74 Ga0436361_0670010 3300039447 Bacteria 47567
75 Ga0436361_0725404 3300039447 Bacteria 18538
76 Ga0436361_0999542 3300039447 Bacteria 11180
77 Ga0436361_1131061 3300039447 Bacteria 989
78 Ga0436362_0185783 3300039453 Bacteria 977
79 Ga0436362_0422570 3300039453 Bacteria 2327
80 Ga0451837_0685943 3300041494 Bacteria 572
81 Ga0466957_0019626 3300044842 Bacteria 3976
82 Ga0466959_0453653 3300045049 Bacteria 869
83 Ga0466958_0002853 3300045836 Bacteria 8797
84 Ga0495594_0017285 3300046499 Bacteria 3809
85 Ga0495587_0310748 3300046536 Bacteria 881
86 Ga0496105_0298306 3300048908 Bacteria 1296
87 Ga0496109_0158504 3300048912 Bacteria 2120
88 Ga0496110_1445546 3300048913 Bacteria 597
89 Ga0496112_0099174 3300048915 Bacteria 2883
90 Ga0501031_0232334 3300049568 Bacteria 1200
91 Ga0501033_0174393 3300049570 Bacteria 1544
92 Ga0501034_0009974 3300049571 Bacteria 9927
93 Ga0501034_0020439 3300049571 Bacteria 6760
94 Ga0501036_0038966 3300049572 Bacteria 4024
95 Ga0501037_0077514 3300049573 Bacteria 2412
96 Ga0501038_0023263 3300049574 Bacteria 5542
97 Ga0501039_0768403 3300049575 Bacteria 752
98 Ga0501040_1270479 3300049576 Bacteria 534
99 Ga0501041_0514772 3300049577 Bacteria 762
100 Ga0501047_0157133 3300049581 Bacteria 2147
101 Ga0501048_0060072 3300049582 Bacteria 2694
102 Ga0501069_0215922 3300049585 Bacteria 1114
103 Ga0501070_0556097 3300049586 Bacteria 918
104 Ga0501073_0100838 3300049589 Bacteria 2005
105 Ga0501035_0317954 3300049822 Bacteria 1308
106 Ga0501035_0376785 3300049822 Bacteria 1184
107 Ga0501044_0167246 3300049823 Bacteria 2172
108 Ga0501045_0684521 3300049824 Bacteria 757
109 nmdc:mga03n38_381579_c1 3300050490 Bacteria 772
110 nmdc:mga04h51_70113_c1 3300050495 Bacteria 1222
111 nmdc:mga05p37_292076_c1 3300050507 Bacteria 1940
112 nmdc:mga05p37_63613_c1 3300050507 Bacteria 4540
113 nmdc:mga05p37_94577_c1 3300050507 Bacteria 3682
114 nmdc:mga09592_1682_c1 3300050508 Bacteria 17835
115 nmdc:mga09592_23439_c1 3300050508 Bacteria 5099
116 nmdc:mga0qj67_154391_c1 3300050509 Bacteria 1863
117 nmdc:mga0qj67_2807_c1 3300050509 Bacteria 12488
118 nmdc:mga06r32_165_c1 3300050510 Bacteria 51639
119 nmdc:mga06r32_229427_c1 3300050510 Bacteria 1845
120 nmdc:mga06r32_262814_c1 3300050510 Bacteria 1713
121 nmdc:mga06r32_29560_c1 3300050510 Bacteria 5139
122 nmdc:mga08y16_272785_c1 3300050511 Bacteria 1746
123 Ga0500642_0364805 3300053130 Bacteria 638
124 Ga0500568_0000186 3300053139 Bacteria 54624
125 Ga0500588_0000496 3300053146 Bacteria 6260
126 2512034869 2511231221 Bacteria 6846400
127 2585313396 2582581314 Bacteria 11452267
128 2812480575 2811994917 Bacteria 7761064
129 2857484421 2857481737 Bacteria 4761446
130 Ga0075363_100450413
131 Ga0070690_100315588
132 Ga0070668_100000103
133 Ga0070668_100892868
134 Ga0070669_100058435
135 Ga0070714_101336131
136 Ga0070700_100000179
137 Ga0070684_100060329
138 Ga0070665_100700103
139 Ga0068855_100118251
140 Ga0068859_100413387
141 Ga0068870_10725444
142 Ga0068862_100019999
143 Ga0068862_100744365
144 Ga0081455_10266030
145 Ga0075368_10094740
146 Ga0075428_100019076
147 Ga0075428_100071379
148 Ga0075428_100289524
149 Ga0075430_100000769
150 Ga0075430_100028584
151 Ga0075430_100364137
152 Ga0075431_100000917
153 Ga0075431_100454339
154 Ga0075429_100002580
155 Ga0075429_100053204
156 Ga0075429_100159496
157 Ga0097620_100413425
158 Ga0105250_10252184
159 Ga0105240_10016149
160 Ga0111539_10006677
161 Ga0111539_10602989
162 Ga0105245_11261264
163 Ga0114129_10064737
164 Ga0114129_10070593
165 Ga0114129_10410927
166 Ga0105248_10034462
167 Ga0105237_11796962
168 Ga0105238_11466204
169 Ga0157378_10269825
170 Ga0163162_11023875
171 Ga0213872_10001537
172 Ga0213872_10019760
173 Ga0207696_1114531
174 Ga0207684_10294220
175 Ga0207695_10052451
176 Ga0207681_10138057
177 Ga0207711_10049734
178 Ga0207689_11379453
179 Ga0207661_10003585
180 Ga0207668_10406923
181 Ga0207658_10101161
182 Ga0207708_10000036
183 Ga0209813_10095698
184 Ga0207428_10168099
185 Ga0268266_10724732
186 Ga0268265_10040456
187 Ga0265325_10222662
188 Ga0265316_10140592
189 Ga0307509_10109710
190 Ga0265313_10051712
191 Ga0307508_10061982
192 Ga0265314_10343237
193 Ga0307518_10215743
194 Ga0307406_10480451
195 Ga0307409_100246381
196 Ga0307409_102180221
197 Ga0307416_101762761
198 Ga0316574_0203908
199 Ga0316574_0778797
200 Ga0373927_0082884
201 Ga0373925_0047144
202 Ga0395905_0660720
203 Ga0436361_0670010
204 Ga0436361_0725404
205 Ga0436361_0999542
206 Ga0436361_1131061
207 Ga0436362_0185783
208 Ga0436362_0422570
209 Ga0451837_0685943
210 Ga0466957_0019626
211 Ga0466959_0453653
212 Ga0466958_0002853
213 Ga0495594_0017285
214 Ga0495587_0310748
215 Ga0496105_0298306
216 Ga0496109_0158504
217 Ga0496110_1445546
218 Ga0496112_0099174
219 Ga0501031_0232334
220 Ga0501033_0174393
221 Ga0501034_0009974
222 Ga0501034_0020439
223 Ga0501036_0038966
224 Ga0501037_0077514
225 Ga0501038_0023263
226 Ga0501039_0768403
227 Ga0501040_1270479
228 Ga0501041_0514772
229 Ga0501047_0157133
230 Ga0501048_0060072
231 Ga0501069_0215922
232 Ga0501070_0556097
233 Ga0501073_0100838
234 Ga0501035_0317954
235 Ga0501035_0376785
236 Ga0501044_0167246
237 Ga0501045_0684521
238 nmdc:mga03n38_381579_c1
239 nmdc:mga04h51_70113_c1
240 nmdc:mga05p37_292076_c1
241 nmdc:mga05p37_63613_c1
242 nmdc:mga05p37_94577_c1
243 nmdc:mga09592_1682_c1
244 nmdc:mga09592_23439_c1
245 nmdc:mga0qj67_154391_c1
246 nmdc:mga0qj67_2807_c1
247 nmdc:mga06r32_165_c1
248 nmdc:mga06r32_229427_c1
249 nmdc:mga06r32_262814_c1
250 nmdc:mga06r32_29560_c1
251 nmdc:mga08y16_272785_c1
252 Ga0500642_0364805
253 Ga0500568_0000186
254 Ga0500588_0000496
255 2512034869
256 2585313396
257 2812480575
258 2857484421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

3

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9208 1 162
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.905 2 159
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9046 1 162
7u4m-assembly1.cif.gz_A crystal structure of human gpx4-u46c in complex with loc1886 0.9023 1 159
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9017 3 162
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9291 2 162 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9259 2 162 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9211 2 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.918 1 159 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9149 2 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4V0WXV4-F1-model_v4 Glutathione peroxidase 0.9727 1 160 GO:0004601
GO:0034599
AF-A0A7X6SJ63-F1-model_v4 Glutathione peroxidase 0.9719 1 160 GO:0004601
GO:0034599
AF-A0A7K0U7J1-F1-model_v4 Glutathione peroxidase 0.9719 1 148 GO:0004601
GO:0034599
AF-A0A0R2PT96-F1-model_v4 Glutathione peroxidase 0.9715 1 160 GO:0004601
GO:0034599
AF-A0A399XP82-F1-model_v4 Glutathione peroxidase 0.9707 1 160 GO:0004601
GO:0034599

Map