F141075

General Info

Members Datasets Scaffolds Average Seq Length
129 90 258 171

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100144979|Ga0070665_1001449792
Length 185
Sequence MHSTTPSRTRDRQTPPPRAERVGRPLYTPDERRRRDASGWTLVQGVLAPVQFLIFAVSLVLVLRYLFTGEGHAAAVASVVVKTLALYAIMVTGSIWEKVVFGKYLFAPAFYWEDVFSMLVLALHTAYLAALATGALADRPLMYLALAAYATYVINATQFILKLRAARLDMARQAQGAGLNGEVAA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
4 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
5 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
6 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
7 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
8 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
9 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
10 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
16 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
17 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
18 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
19 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
20 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
21 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
22 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
23 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
24 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
25 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
26 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
27 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
28 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
29 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
30 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
31 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
32 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
35 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
39 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
40 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
41 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
49 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
53 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
54 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
55 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
61 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
62 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
65 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
72 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
73 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
74 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
75 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
76 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
77 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
78 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
79 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
80 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
81 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
82 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
83 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
84 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
85 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
86 2643221660 Methylibium sp. Root1272 Isolate Unclassified
87 2643221719 Rhizobium sp. Root274 Isolate Unclassified
88 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
89 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
90 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.92
Metatranscriptomes 4.65
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0.78
Rhizoplane 1.55
Rhizosphere 80.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100144979 3300005548 Bacteria 2378
2 Ga0070668_100881287 3300005347 Bacteria 799
3 Ga0070672_100060844 3300005543 Bacteria 2975
4 Ga0070665_100008387 3300005548 Bacteria 10452
5 Ga0070665_100368909 3300005548 Bacteria 1442
6 Ga0068852_101004989 3300005616 Bacteria 853
7 Ga0075370_10297661 3300006353 Bacteria 959
8 Ga0068871_100457313 3300006358 Bacteria 1145
9 Ga0068871_101698769 3300006358 Bacteria 599
10 Ga0157369_10180238 3300013105 Bacteria 2223
11 Ga0157378_10042544 3300013297 Bacteria 4032
12 Ga0163162_11845373 3300013306 Bacteria 691
13 Ga0209563_106160 3300025230 Bacteria 2087
14 Ga0207644_10377082 3300025931 Bacteria 1156
15 Ga0207691_10051244 3300025940 Bacteria 3775
16 Ga0207678_10117414 3300026067 Bacteria 2270
17 Ga0268266_10025393 3300028379 Bacteria 5040
18 Ga0268266_11002981 3300028379 Bacteria 808
19 Ga0268266_11243350 3300028379 Bacteria 720
20 Ga0265334_10000294 3300028573 Bacteria 27911
21 Ga0265338_10031815 3300028800 Bacteria 5163
22 Ga0265330_10033087 3300031235 Bacteria 2314
23 Ga0265332_10006020 3300031238 Bacteria 5545
24 Ga0265328_10149478 3300031239 Bacteria 878
25 Ga0265320_10017189 3300031240 Bacteria 4026
26 Ga0265325_10030307 3300031241 Bacteria 2901
27 Ga0265329_10004922 3300031242 Bacteria 5471
28 Ga0265340_10084819 3300031247 Bacteria 1487
29 Ga0265339_10197294 3300031249 Bacteria 994
30 Ga0265331_10004809 3300031250 Bacteria 8316
31 Ga0265327_10008611 3300031251 Bacteria 7564
32 Ga0265327_10011604 3300031251 Bacteria 6044
33 Ga0265327_10052370 3300031251 Bacteria 2126
34 Ga0265316_10037710 3300031344 Bacteria 3898
35 Ga0265313_10004120 3300031595 Bacteria 11311
36 Ga0316575_10027578 3300031665 Bacteria 2209
37 Ga0316579_10008717 3300031691 Bacteria 4239
38 Ga0316579_10067124 3300031691 Bacteria 1694
39 Ga0265314_10022996 3300031711 Bacteria 4764
40 Ga0265314_10105443 3300031711 Bacteria 1802
41 Ga0265342_10006928 3300031712 Bacteria 8377
42 Ga0316576_10000980 3300031727 Bacteria 14661
43 Ga0316576_10013682 3300031727 Bacteria 5403
44 Ga0316576_10059432 3300031727 Bacteria 2798
45 Ga0316578_10009373 3300031728 Bacteria 5035
46 Ga0316578_10011089 3300031728 Bacteria 4699
47 Ga0316578_10015497 3300031728 Bacteria 4100
48 Ga0316578_10043898 3300031728 Bacteria 2598
49 Ga0316577_10000523 3300031733 Bacteria 15428
50 Ga0316577_10003091 3300031733 Bacteria 8359
51 Ga0316577_10036070 3300031733 Bacteria 2764
52 Ga0307410_11564078 3300031852 Bacteria 582
53 Ga0307414_10691472 3300032004 Bacteria 923
54 Ga0316583_10004398 3300032133 Bacteria 5025
55 Ga0316585_10007535 3300032137 Bacteria 3141
56 Ga0316585_10011234 3300032137 Bacteria 2638
57 Ga0316580_10000729 3300032139 Bacteria 7951
58 Ga0316580_10001056 3300032139 Bacteria 6921
59 Ga0316593_10101825 3300032168 Bacteria 1019
60 Ga0307510_10038638 3300033180 Bacteria 5274
61 Ga0316592_1069859 3300033524 Bacteria 794
62 Ga0316586_1005722 3300033527 Bacteria 1760
63 Ga0316588_1000028 3300033528 Bacteria 10646
64 Ga0316588_1002842 3300033528 Bacteria 3075
65 Ga0316596_1105723 3300033541 Bacteria 762
66 Ga0316574_0015799 3300035398 Bacteria 4384
67 Ga0316574_0019238 3300035398 Bacteria 4026
68 Ga0373933_0665029 3300035724 Bacteria 685
69 Ga0373937_0164095 3300036401 Bacteria 2083
70 Ga0316582_0013243 3300036647 Bacteria 4636
71 Ga0316582_0016030 3300036647 Bacteria 4301
72 Ga0316582_0041264 3300036647 Bacteria 2883
73 Ga0316584_0000497 3300036712 Bacteria 20762
74 Ga0316584_0002621 3300036712 Bacteria 11464
75 Ga0316584_0037910 3300036712 Bacteria 3584
76 Ga0316584_0110793 3300036712 Bacteria 2054
77 Ga0316584_0117122 3300036712 Bacteria 1992
78 Ga0316581_0006970 3300037588 Bacteria 3012
79 Ga0316581_0184168 3300037588 Bacteria 644
80 Ga0451839_0544198 3300041496 Bacteria 794
81 Ga0451841_0287156 3300041498 Bacteria 1054
82 Ga0451849_0786284 3300041505 Bacteria 1000
83 Ga0451577_0002497 3300042876 Bacteria 21820
84 Ga0451577_0005404 3300042876 Bacteria 13106
85 Ga0451577_0144383 3300042876 Bacteria 2139
86 Ga0451577_0191725 3300042876 Bacteria 1844
87 Ga0451577_0644484 3300042876 Bacteria 961
88 Ga0453684_0048775 3300044712 Bacteria 5593
89 Ga0453684_0087457 3300044712 Bacteria 3862
90 Ga0453684_0540382 3300044712 Bacteria 1285
91 Ga0453684_1581352 3300044712 Bacteria 674
92 Ga0466968_0002455 3300044735 Bacteria 6801
93 Ga0451576_0003215 3300045051 Bacteria 22783
94 Ga0451576_0054820 3300045051 Bacteria 4173
95 Ga0451576_0327923 3300045051 Bacteria 1602
96 Ga0451576_1529082 3300045051 Bacteria 693
97 Ga0451576_1733826 3300045051 Bacteria 646
98 Ga0495607_0064773 3300046501 Bacteria 2063
99 Ga0495667_0161170 3300046559 Bacteria 1443
100 Ga0495635_0199036 3300046663 Bacteria 1359
101 Ga0495600_0107877 3300046809 Bacteria 1814
102 Ga0495600_0283663 3300046809 Bacteria 1048
103 Ga0495674_0101832 3300047319 Bacteria 2443
104 Ga0495684_0040828 3300047471 Bacteria 3556
105 Ga0495686_0007202 3300047472 Bacteria 8376
106 Ga0496109_0249656 3300048912 Bacteria 1671
107 Ga0496110_0678007 3300048913 Bacteria 931
108 Ga0496122_0192744 3300048925 Bacteria 1201
109 Ga0496123_0082955 3300048926 Bacteria 1940
110 Ga0501280_013521 3300049776 Bacteria 1154
111 Ga0501282_002267 3300049778 Bacteria 2112
112 Ga0495595_0172583 3300053084 Bacteria 1071
113 Ga0495619_0354097 3300053085 Bacteria 1015
114 Ga0500644_0001793 3300053088 Bacteria 5548
115 Ga0500651_0010363 3300053093 Bacteria 5585
116 Ga0500594_0000434 3300053118 Bacteria 9235
117 Ga0500559_0000109 3300053136 Bacteria 65246
118 Ga0500568_0008211 3300053139 Bacteria 5055
119 Ga0500622_0006031 3300053156 Bacteria 7122
120 Ga0500636_0133297 3300053177 Bacteria 1382
121 Ga0500587_000122 3300053739 Bacteria 7181
122 Ga0500661_034886 3300055283 Bacteria 889
123 2644299556 2643221653 Bacteria 4569637
124 2644301495 2643221654 Bacteria 5273570
125 2644338217 2643221660 Bacteria 4208257
126 2644657784 2643221719 Bacteria 4568197
127 2829750139 2829745981 Bacteria 5406054
128 2842336635 2842333319 Bacteria 8899485
129 2989780666 2989776772 Bacteria 4843317
130 Ga0070665_100144979
131 Ga0070668_100881287
132 Ga0070672_100060844
133 Ga0070665_100008387
134 Ga0070665_100368909
135 Ga0068852_101004989
136 Ga0075370_10297661
137 Ga0068871_100457313
138 Ga0068871_101698769
139 Ga0157369_10180238
140 Ga0157378_10042544
141 Ga0163162_11845373
142 Ga0209563_106160
143 Ga0207644_10377082
144 Ga0207691_10051244
145 Ga0207678_10117414
146 Ga0268266_10025393
147 Ga0268266_11002981
148 Ga0268266_11243350
149 Ga0265334_10000294
150 Ga0265338_10031815
151 Ga0265330_10033087
152 Ga0265332_10006020
153 Ga0265328_10149478
154 Ga0265320_10017189
155 Ga0265325_10030307
156 Ga0265329_10004922
157 Ga0265340_10084819
158 Ga0265339_10197294
159 Ga0265331_10004809
160 Ga0265327_10008611
161 Ga0265327_10011604
162 Ga0265327_10052370
163 Ga0265316_10037710
164 Ga0265313_10004120
165 Ga0316575_10027578
166 Ga0316579_10008717
167 Ga0316579_10067124
168 Ga0265314_10022996
169 Ga0265314_10105443
170 Ga0265342_10006928
171 Ga0316576_10000980
172 Ga0316576_10013682
173 Ga0316576_10059432
174 Ga0316578_10009373
175 Ga0316578_10011089
176 Ga0316578_10015497
177 Ga0316578_10043898
178 Ga0316577_10000523
179 Ga0316577_10003091
180 Ga0316577_10036070
181 Ga0307410_11564078
182 Ga0307414_10691472
183 Ga0316583_10004398
184 Ga0316585_10007535
185 Ga0316585_10011234
186 Ga0316580_10000729
187 Ga0316580_10001056
188 Ga0316593_10101825
189 Ga0307510_10038638
190 Ga0316592_1069859
191 Ga0316586_1005722
192 Ga0316588_1000028
193 Ga0316588_1002842
194 Ga0316596_1105723
195 Ga0316574_0015799
196 Ga0316574_0019238
197 Ga0373933_0665029
198 Ga0373937_0164095
199 Ga0316582_0013243
200 Ga0316582_0016030
201 Ga0316582_0041264
202 Ga0316584_0000497
203 Ga0316584_0002621
204 Ga0316584_0037910
205 Ga0316584_0110793
206 Ga0316584_0117122
207 Ga0316581_0006970
208 Ga0316581_0184168
209 Ga0451839_0544198
210 Ga0451841_0287156
211 Ga0451849_0786284
212 Ga0451577_0002497
213 Ga0451577_0005404
214 Ga0451577_0144383
215 Ga0451577_0191725
216 Ga0451577_0644484
217 Ga0453684_0048775
218 Ga0453684_0087457
219 Ga0453684_0540382
220 Ga0453684_1581352
221 Ga0466968_0002455
222 Ga0451576_0003215
223 Ga0451576_0054820
224 Ga0451576_0327923
225 Ga0451576_1529082
226 Ga0451576_1733826
227 Ga0495607_0064773
228 Ga0495667_0161170
229 Ga0495635_0199036
230 Ga0495600_0107877
231 Ga0495600_0283663
232 Ga0495674_0101832
233 Ga0495684_0040828
234 Ga0495686_0007202
235 Ga0496109_0249656
236 Ga0496110_0678007
237 Ga0496122_0192744
238 Ga0496123_0082955
239 Ga0501280_013521
240 Ga0501282_002267
241 Ga0495595_0172583
242 Ga0495619_0354097
243 Ga0500644_0001793
244 Ga0500651_0010363
245 Ga0500594_0000434
246 Ga0500559_0000109
247 Ga0500568_0008211
248 Ga0500622_0006031
249 Ga0500636_0133297
250 Ga0500587_000122
251 Ga0500661_034886
252 2644299556
253 2644301495
254 2644338217
255 2644657784
256 2829750139
257 2842336635
258 2989780666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07284

BCHF

2-vinyl bacteriochlorophyllide hydratase (BCHF)

27

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8drj-assembly1.cif.gz_C apo b2 dimer (h60/h100/h104) formed in the presence of cu(ii) 0.7417 40 148
4qim-assembly1.cif.gz_A structure of the human smoothened receptor in complex with anta xv 0.736 31 152
3nmi-assembly6.cif.gz_F crystal structure of the phenanthroline-modified cytochrome cb562 variant, mbp-phen2 0.7349 40 148
5l31-assembly1.cif.gz_B crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. 0.7282 40 148
3hni-assembly1.cif.gz_A crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1 0.7275 40 148
ID Description Score Start End Superfamily
2bc5D00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7276 40 148 1.20.120.10
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.726 40 148 1.20.120.10
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7234 35 148 1.20.120.1770
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7159 35 154 1.20.120.1770
4u9dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7156 40 148 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A2D7D3D5-F1-model_v4 deleted 1.001 17 165
AF-A0A368EE75-F1-model_v4 2-vinyl bacteriochlorophyllide hydratase (EC 4.2.1.-) 1.001 16 165 GO:0016020
GO:0016836
GO:0019685
GO:0030494
AF-A0A2K8UIR2-F1-model_v4 2-vinyl bacteriochlorophyllide hydratase 0.9944 15 165 GO:0016020
GO:0016836
GO:0019685
GO:0030494
AF-A0A0K8NVT4-F1-model_v4 2-vinyl bacteriochlorophyllide hydratase BchF (EC 4.2.1.-) 0.9943 11 158 GO:0016020
GO:0016836
GO:0019685
GO:0030494
AF-A0A512DSL8-F1-model_v4 2-vinyl bacteriochlorophyllide hydratase 0.9914 12 162 GO:0016020
GO:0016836
GO:0019685
GO:0030494

Map