F139851

General Info

Members Datasets Scaffolds Average Seq Length
128 105 256 285

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154203|2516091411
Length 325
Sequence PPADRVGAADTPGRSAEAARGEEPGMVEEPGMVEEPGMVEEPGMVEVVRAGALTTVQDLGRPGWAHLGVPRSGALDPSALRLANRLVGNPETAAGLEITLTGCELRFRGATTVAVTGADVPVRVNDRPGDVGRPLAVPAGAVLRVGPPRTGLRSWLAVAGGFAVEPVLGSRATDTLSGLGPPLLRDGDRLPMGVPAGPPAPVDATATVPTPAEVRLALRLGPRADWFTPLALELLLGTAYTLTPLSNRIGARLSGAPLPRAVVGELPSEGLVLGAVQVPADGQPLVFLADHPTTGGYPVVGVVVDVTPLAQARPGTTVRFHGSQR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
3 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
6 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
39 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
50 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
51 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
52 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
53 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
54 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
55 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
56 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
61 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
62 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
63 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
64 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
65 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
66 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
67 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
68 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
69 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
70 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
71 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
72 2619618881 Frankia sp. ACN1ag Isolate Unclassified
73 2619619003 Frankia sp. CpI1-P Isolate Nodule
74 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
75 2626541554 Frankia sp. AvcI.1 Isolate Nodule
76 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
77 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
78 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
79 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
80 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
81 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
82 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
83 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
84 2858882152 Micromonospora noduli MED15 Isolate Nodule
85 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
86 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
87 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
88 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
89 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
90 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
91 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
92 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
93 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
94 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
95 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
96 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
97 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
98 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
99 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
100 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
101 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
102 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
103 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
104 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
105 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.75
Metatranscriptomes 0
Isolates 31.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 5.47
Rhizoplane 4.69
Rhizosphere 60.94
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100002517 3300005347 Bacteria 13492
2 Ga0070681_10260254 3300005458 Bacteria 1647
3 Ga0070684_100129942 3300005535 Bacteria 2272
4 Ga0070684_100204472 3300005535 Bacteria 1799
5 Ga0070684_100283639 3300005535 Bacteria 1517
6 Ga0068855_100186409 3300005563 Bacteria 2343
7 Ga0068857_100008852 3300005577 Bacteria 8720
8 Ga0068864_100061740 3300005618 Bacteria 3246
9 Ga0068863_100147378 3300005841 Bacteria 2251
10 Ga0068858_100801582 3300005842 Bacteria 919
11 Ga0068862_100012227 3300005844 Bacteria 7097
12 Ga0081540_1002986 3300005983 Bacteria 13558
13 Ga0081539_10000143 3300005985 Bacteria 165345
14 Ga0081539_10001530 3300005985 Bacteria 38732
15 Ga0070712_100137123 3300006175 Bacteria 1862
16 Ga0075428_100332945 3300006844 Bacteria 1631
17 Ga0075431_100064379 3300006847 Bacteria 3786
18 Ga0105251_10021545 3300009011 Bacteria 3362
19 Ga0105247_10000013 3300009101 Bacteria 287863
20 Ga0114129_10325975 3300009147 Bacteria 2040
21 Ga0105248_10005500 3300009177 Bacteria 13909
22 Ga0105248_10108011 3300009177 Bacteria 3138
23 Ga0105248_10144016 3300009177 Bacteria 2689
24 Ga0163163_10001247 3300014325 Bacteria 21442
25 Ga0163163_10011117 3300014325 Bacteria 8148
26 Ga0163163_10361438 3300014325 Bacteria 1508
27 Ga0157379_10000621 3300014968 Bacteria 28649
28 Ga0157379_10064178 3300014968 Bacteria 3282
29 Ga0207713_1041099 3300025735 Bacteria 1932
30 Ga0207710_10000030 3300025900 Bacteria 287870
31 Ga0207711_10067659 3300025941 Bacteria 3093
32 Ga0207679_10305233 3300025945 Bacteria 1373
33 Ga0207703_10129517 3300026035 Bacteria 2177
34 Ga0207678_10488997 3300026067 Bacteria 1072
35 Ga0207641_10292808 3300026088 Bacteria 1535
36 Ga0207676_10007537 3300026095 Bacteria 7722
37 Ga0268265_10040600 3300028380 Bacteria 3438
38 Ga0307517_10027878 3300028786 Bacteria 6761
39 Ga0307515_10008239 3300028794 Bacteria 20370
40 Ga0307515_10019616 3300028794 Bacteria 12148
41 Ga0307515_10166433 3300028794 Bacteria 2220
42 Ga0307512_10008006 3300030522 Bacteria 10371
43 Ga0307512_10090267 3300030522 Bacteria 2138
44 Ga0307513_10006303 3300031456 Bacteria 15542
45 Ga0307513_10008299 3300031456 Bacteria 13309
46 Ga0307408_100060804 3300031548 Bacteria 2755
47 Ga0307508_10027327 3300031616 Bacteria 5165
48 Ga0307405_10066711 3300031731 Bacteria 2295
49 Ga0307405_10088608 3300031731 Bacteria 2042
50 Ga0307410_10094337 3300031852 Bacteria 2131
51 Ga0307410_10136676 3300031852 Bacteria 1808
52 Ga0326468_10001098 3300031889 Bacteria 2506
53 Ga0307406_10028621 3300031901 Bacteria 3368
54 Ga0307406_10093870 3300031901 Bacteria 2027
55 Ga0307412_10302990 3300031911 Bacteria 1264
56 Ga0307409_100000143 3300031995 Bacteria 26789
57 Ga0307409_100044414 3300031995 Bacteria 3347
58 Ga0307416_100003635 3300032002 Bacteria 9110
59 Ga0307416_100008698 3300032002 Bacteria 6575
60 Ga0307416_100223340 3300032002 Bacteria 1809
61 Ga0307416_100799700 3300032002 Bacteria 1039
62 Ga0307411_10208817 3300032005 Bacteria 1506
63 Ga0307415_100000005 3300032126 Bacteria 109697
64 Ga0307415_100025076 3300032126 Bacteria 3736
65 Ga0307415_100031768 3300032126 Bacteria 3406
66 Ga0307415_100138243 3300032126 Bacteria 1856
67 Ga0373951_0000045 3300035091 Bacteria 49514
68 Ga0373955_0051794 3300035172 Bacteria 2237
69 Ga0466967_0013073 3300045976 Bacteria 6392
70 Ga0495629_0185659 3300046459 Bacteria 1440
71 Ga0496104_0133619 3300048907 Bacteria 2383
72 Ga0496105_0010695 3300048908 Bacteria 7221
73 Ga0496108_0000074 3300048911 Bacteria 108445
74 Ga0496108_0109534 3300048911 Bacteria 2360
75 Ga0496109_0004092 3300048912 Bacteria 12190
76 Ga0496113_0015131 3300048916 Bacteria 5290
77 Ga0496119_0000169 3300048922 Bacteria 91606
78 Ga0496120_0000325 3300048923 Bacteria 79080
79 Ga0496126_0000090 3300048929 Bacteria 210538
80 Ga0501040_0063696 3300049576 Bacteria 2537
81 Ga0501041_0054714 3300049577 Bacteria 2435
82 Ga0501046_0217102 3300049580 Unclassified 1418
83 Ga0501072_0079318 3300049588 Bacteria 2600
84 Ga0501081_0020462 3300049743 Bacteria 4411
85 nmdc:mga05p37_382636_c1 3300050507 Bacteria 1648
86 nmdc:mga0qj67_222259_c1 3300050509 Bacteria 1533
87 nmdc:mga08y16_372100_c1 3300050511 Bacteria 1465
88 Ga0500646_0000018 3300053090 Bacteria 54503
89 2516091411 2515154203 Bacteria 5458536
90 2515495573 2515154088 Bacteria 5526283
91 2515722566 2515154129 Bacteria 5584369
92 2515756132 2515154137 Bacteria 5711575
93 2516084665 2515154202 Bacteria 5471270
94 2600813150 2600255067 Bacteria 6795583
95 2619853329 2619618881 Bacteria 7521104
96 2620350225 2619619003 Bacteria 7619552
97 2623585923 2622736626 Bacteria 7181580
98 2626634053 2626541554 Bacteria 7741902
99 2676486205 2675903059 Bacteria 8644972
100 2772642713 2772190715 Bacteria 6959372
101 2831940892 2831935698 Bacteria 5963223
102 2832005220 2832004796 Bacteria 6538017
103 2855671890 2855670206 Bacteria 7120389
104 2855676975 2855676851 Bacteria 7063653
105 2857290521 2857288857 Bacteria 7189066
106 2858852537 2858848962 Bacteria 6963058
107 2858884525 2858882152 Bacteria 7230291
108 2858893081 2858888857 Bacteria 7060307
109 2858898691 2858895516 Bacteria 7378898
110 2858904788 2858902515 Bacteria 7086037
111 2866070492 2866065130 Bacteria 6518152
112 2867304566 2867302475 Bacteria 7087181
113 2867319015 2867312974 Bacteria 7058875
114 2867324579 2867319477 Bacteria 7069771
115 2867508965 2867507094 Bacteria 6506033
116 2869053211 2869048445 Bacteria 6875584
117 2869064657 2869061728 Bacteria 7112407
118 2869074253 2869068681 Bacteria 7205615
119 2880494344 2880489317 Bacteria 7096270
120 2880497974 2880495981 Bacteria 7340502
121 2929220023 2929219909 Bacteria 6984360
122 2929226541 2929226422 Bacteria 7248583
123 2996225988 2996221748 Bacteria 6799777
124 8003835398 8003830390 Bacteria 6541657
125 8003861309 8003856774 Bacteria 7675274
126 8054710618 8054704163 Bacteria 7247792
127 8054729255 8054727385 Bacteria 7558670
128 8054737059 8054734606 Bacteria 6947278
129 Ga0070668_100002517
130 Ga0070681_10260254
131 Ga0070684_100129942
132 Ga0070684_100204472
133 Ga0070684_100283639
134 Ga0068855_100186409
135 Ga0068857_100008852
136 Ga0068864_100061740
137 Ga0068863_100147378
138 Ga0068858_100801582
139 Ga0068862_100012227
140 Ga0081540_1002986
141 Ga0081539_10000143
142 Ga0081539_10001530
143 Ga0070712_100137123
144 Ga0075428_100332945
145 Ga0075431_100064379
146 Ga0105251_10021545
147 Ga0105247_10000013
148 Ga0114129_10325975
149 Ga0105248_10005500
150 Ga0105248_10108011
151 Ga0105248_10144016
152 Ga0163163_10001247
153 Ga0163163_10011117
154 Ga0163163_10361438
155 Ga0157379_10000621
156 Ga0157379_10064178
157 Ga0207713_1041099
158 Ga0207710_10000030
159 Ga0207711_10067659
160 Ga0207679_10305233
161 Ga0207703_10129517
162 Ga0207678_10488997
163 Ga0207641_10292808
164 Ga0207676_10007537
165 Ga0268265_10040600
166 Ga0307517_10027878
167 Ga0307515_10008239
168 Ga0307515_10019616
169 Ga0307515_10166433
170 Ga0307512_10008006
171 Ga0307512_10090267
172 Ga0307513_10006303
173 Ga0307513_10008299
174 Ga0307408_100060804
175 Ga0307508_10027327
176 Ga0307405_10066711
177 Ga0307405_10088608
178 Ga0307410_10094337
179 Ga0307410_10136676
180 Ga0326468_10001098
181 Ga0307406_10028621
182 Ga0307406_10093870
183 Ga0307412_10302990
184 Ga0307409_100000143
185 Ga0307409_100044414
186 Ga0307416_100003635
187 Ga0307416_100008698
188 Ga0307416_100223340
189 Ga0307416_100799700
190 Ga0307411_10208817
191 Ga0307415_100000005
192 Ga0307415_100025076
193 Ga0307415_100031768
194 Ga0307415_100138243
195 Ga0373951_0000045
196 Ga0373955_0051794
197 Ga0466967_0013073
198 Ga0495629_0185659
199 Ga0496104_0133619
200 Ga0496105_0010695
201 Ga0496108_0000074
202 Ga0496108_0109534
203 Ga0496109_0004092
204 Ga0496113_0015131
205 Ga0496119_0000169
206 Ga0496120_0000325
207 Ga0496126_0000090
208 Ga0501040_0063696
209 Ga0501041_0054714
210 Ga0501046_0217102
211 Ga0501072_0079318
212 Ga0501081_0020462
213 nmdc:mga05p37_382636_c1
214 nmdc:mga0qj67_222259_c1
215 nmdc:mga08y16_372100_c1
216 Ga0500646_0000018
217 2516091411
218 2515495573
219 2515722566
220 2515756132
221 2516084665
222 2600813150
223 2619853329
224 2620350225
225 2623585923
226 2626634053
227 2676486205
228 2772642713
229 2831940892
230 2832005220
231 2855671890
232 2855676975
233 2857290521
234 2858852537
235 2858884525
236 2858893081
237 2858898691
238 2858904788
239 2866070492
240 2867304566
241 2867319015
242 2867324579
243 2867508965
244 2869053211
245 2869064657
246 2869074253
247 2880494344
248 2880497974
249 2929220023
250 2929226541
251 2996225988
252 8003835398
253 8003861309
254 8054710618
255 8054729255
256 8054737059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

67

322

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.898 2 280
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.892 2 280
3ore-assembly1.cif.gz_A crystal structure of ttha0988 in space group p6522 0.8687 2 277
3oep-assembly1.cif.gz_A crystal structure of ttha0988 in space group p43212 0.8615 2 277
3opf-assembly1.cif.gz_A crystal structure of ttha0988 in space group p212121 0.8562 2 277
ID Description Score Start End Superfamily
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9043 174 279 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8993 172 280 2.40.100.10
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8889 174 280 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8812 174 280 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8551 172 280 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A6N9UMQ7-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9813 1 115 GO:0005524
GO:0016740
GO:0016787
AF-A0A6G3SGI1-F1-model_v4 Allophanate hydrolase subunit 2 family protein 0.9779 1 131 GO:0005524
GO:0016787
AF-A0A7R7DAM5-F1-model_v4 deleted 0.9761 1 136
AF-A0A7X1W426-F1-model_v4 deleted 0.9759 1 128
AF-A0A832JWH0-F1-model_v4 Allophanate hydrolase 0.9737 1 133 GO:0005524
GO:0016787

Map