F139836

General Info

Members Datasets Scaffolds Average Seq Length
128 106 256 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501039|2508674421
Length 312
Sequence VTGATGTVGRHVVRGLAEAGLPVRAFVRDAGAAAGALGPGVELAVGDFADRDALARALSGVDRLFLACGNVPGQVGHERAAIDAAVSAGVGRVVKLSGPDPYPASPLVFDSWHGVIEQHLAASGLPAVLLRPRTYLTNLLAYAQAIASMGMLFAPAGTAEISFVDPRDVADVAVECLAGDGHEGRAYALTGPEAITFERVARELGTATGRYVRYVNVSDDDARRAMTADGVPGAVADAIVAIFAAQRTGWMATTTTDVRNVTGRAPRSIADFARDHAELFGPASAGDGRGGDGRGGEDGGAEIALAKAGDLA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
78 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
79 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
80 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
81 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
82 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
83 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
84 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
85 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 2508501039 Frankia saprophytica CN3 Isolate Nodule
101 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
102 2687453737 Frankia sp. BMG5.36 Isolate Nodule
103 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
104 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
105 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
106 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 3.12
Rhizoplane 0
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10136155 3300003322 Bacteria 1605
2 Ga0070674_100119075 3300005356 Bacteria 1952
3 Ga0070713_100332534 3300005436 Unclassified 1406
4 Ga0070708_100005876 3300005445 Bacteria 9745
5 Ga0070663_100037954 3300005455 Bacteria 3357
6 Ga0070706_100015843 3300005467 Bacteria 6959
7 Ga0070706_100232434 3300005467 Unclassified 1721
8 Ga0070707_100005558 3300005468 Bacteria 11775
9 Ga0070707_100255190 3300005468 Bacteria 1706
10 Ga0070698_100023788 3300005471 Bacteria 6398
11 Ga0070698_100192366 3300005471 Bacteria 1977
12 Ga0070697_100058819 3300005536 Unclassified 3128
13 Ga0068853_100016641 3300005539 Bacteria 6055
14 Ga0068853_100066851 3300005539 Unclassified 3122
15 Ga0068855_100000878 3300005563 Bacteria 37283
16 Ga0068854_100117495 3300005578 Bacteria 2014
17 Ga0070702_100206104 3300005615 Bacteria 1305
18 Ga0068859_100000043 3300005617 Bacteria 156893
19 Ga0068862_100000009 3300005844 Bacteria 298620
20 Ga0070717_10049801 3300006028 Bacteria 3440
21 Ga0070716_100033982 3300006173 Bacteria 2793
22 Ga0075367_10040975 3300006178 Bacteria 2705
23 Ga0075366_10037763 3300006195 Bacteria 2852
24 Ga0075370_10019803 3300006353 Bacteria 3667
25 Ga0075430_100010936 3300006846 Bacteria 7689
26 Ga0075431_100035400 3300006847 Bacteria 5141
27 Ga0075431_100664670 3300006847 Unclassified 1021
28 Ga0075434_100051413 3300006871 Bacteria 4096
29 Ga0075429_100083225 3300006880 Bacteria 2789
30 Ga0068865_100267858 3300006881 Bacteria 1355
31 Ga0097620_100000043 3300006931 Bacteria 156893
32 Ga0075435_100138544 3300007076 Unclassified 2040
33 Ga0075435_100310654 3300007076 Unclassified 1349
34 Ga0111539_10021260 3300009094 Bacteria 7989
35 Ga0105245_10002136 3300009098 Bacteria 17896
36 Ga0105245_10423135 3300009098 Bacteria 1335
37 Ga0114129_10216720 3300009147 Bacteria 2585
38 Ga0114129_10467233 3300009147 Bacteria 1653
39 Ga0114129_10696886 3300009147 Unclassified 1306
40 Ga0105248_10000460 3300009177 Bacteria 46329
41 Ga0163162_10154894 3300013306 Bacteria 2411
42 Ga0163163_10002266 3300014325 Bacteria 16224
43 Ga0157377_10286512 3300014745 Bacteria 1082
44 Ga0207684_10171676 3300025910 Bacteria 1869
45 Ga0207687_10001921 3300025927 Bacteria 14301
46 Ga0207687_10302609 3300025927 Bacteria 1288
47 Ga0207669_10278495 3300025937 Bacteria 1260
48 Ga0207704_10250322 3300025938 Bacteria 1330
49 Ga0207711_10000314 3300025941 Bacteria 51767
50 Ga0207679_10042297 3300025945 Bacteria 3274
51 Ga0207667_10007666 3300025949 Bacteria 12923
52 Ga0207712_10006571 3300025961 Bacteria 7339
53 Ga0207640_10095530 3300025981 Bacteria 2070
54 Ga0207639_10011637 3300026041 Bacteria 6114
55 Ga0207678_10178350 3300026067 Bacteria 1814
56 Ga0207648_10244285 3300026089 Bacteria 1599
57 Ga0207698_10113432 3300026142 Bacteria 2277
58 Ga0268265_10000050 3300028380 Bacteria 175787
59 Ga0265324_10000041 3300029957 Bacteria 113679
60 Ga0265327_10051289 3300031251 Bacteria 2154
61 Ga0307408_100021111 3300031548 Bacteria 4403
62 Ga0307408_100233694 3300031548 Bacteria 1507
63 Ga0307514_10011432 3300031649 Bacteria 7377
64 Ga0307514_10177411 3300031649 Bacteria 1380
65 Ga0265314_10125556 3300031711 Bacteria 1608
66 Ga0265342_10109485 3300031712 Bacteria 1565
67 Ga0307516_10011882 3300031730 Bacteria 9423
68 Ga0307405_10029641 3300031731 Bacteria 3200
69 Ga0307410_10048715 3300031852 Bacteria 2840
70 Ga0307410_10316281 3300031852 Bacteria 1237
71 Ga0326468_10000191 3300031889 Bacteria 6245
72 Ga0307406_10009586 3300031901 Bacteria 5439
73 Ga0307406_10041897 3300031901 Bacteria 2856
74 Ga0307407_10023948 3300031903 Bacteria 3193
75 Ga0307412_10046172 3300031911 Bacteria 2853
76 Ga0307409_100005434 3300031995 Bacteria 7334
77 Ga0307409_100066725 3300031995 Bacteria 2838
78 Ga0307409_100246740 3300031995 Bacteria 1630
79 Ga0307416_100045840 3300032002 Bacteria 3445
80 Ga0307416_100290431 3300032002 Bacteria 1618
81 Ga0307414_10270769 3300032004 Bacteria 1422
82 Ga0307415_100096451 3300032126 Bacteria 2155
83 Ga0307415_100355788 3300032126 Bacteria 1234
84 Ga0307510_10026676 3300033180 Bacteria 6635
85 Ga0373951_0000032 3300035091 Bacteria 54432
86 Ga0395898_0002459 3300037466 Bacteria 21851
87 Ga0395898_0138960 3300037466 Bacteria 2326
88 Ga0395905_0582930 3300037471 Bacteria 1020
89 Ga0436364_0097256 3300037853 Bacteria 1130
90 Ga0436364_0291783 3300037853 Unclassified 3360
91 Ga0395901_0370506 3300038443 Bacteria 1475
92 Ga0436365_0230732 3300039437 Unclassified 1500
93 Ga0436362_0659285 3300039453 Bacteria 9348
94 Ga0451853_0871378 3300041512 Bacteria 3221
95 Ga0439443_026873 3300042003 Bacteria 933
96 Ga0439448_0022265 3300042005 Bacteria 1968
97 Ga0439450_004369 3300042008 Bacteria 2408
98 Ga0439454_002289 3300042011 Bacteria 1995
99 Ga0439463_002179 3300042016 Bacteria 5045
100 Ga0450917_002725 3300042120 Bacteria 1272
101 Ga0450891_006617 3300042129 Bacteria 1066
102 Ga0450902_013044 3300042137 Bacteria 1336
103 Ga0439464_0000379 3300042439 Bacteria 8693
104 Ga0450901_011141 3300042533 Bacteria 933
105 Ga0439440_0007835 3300042993 Bacteria 2178
106 Ga0466963_0220132 3300044694 Bacteria 1329
107 Ga0466967_0011738 3300045976 Bacteria 6658
108 Ga0496118_0059684 3300048921 Bacteria 2838
109 Ga0501034_0069169 3300049571 Bacteria 3541
110 Ga0501034_0285720 3300049571 Bacteria 1589
111 Ga0501036_0008008 3300049572 Bacteria 8648
112 Ga0501038_0020784 3300049574 Bacteria 5900
113 Ga0501035_0000670 3300049822 Bacteria 37580
114 nmdc:mga0k408_11025_c1 3300050493 Bacteria 4908
115 nmdc:mga06z11_11533_c1 3300050494 Bacteria 3815
116 nmdc:mga07m45_20231_c2 3300050496 Bacteria 2985
117 nmdc:mga05p37_25536_c1 3300050507 Bacteria 7187
118 nmdc:mga05p37_918221_c1 3300050507 Unclassified 941
119 nmdc:mga06r32_71473_c1 3300050510 Bacteria 3358
120 nmdc:mga0n895_5756_c1 3300050512 Bacteria 10402
121 nmdc:mga0rr50_173153_c1 3300050513 Unclassified 1760
122 2508674421 2508501039 Bacteria 9978592
123 2676199148 2675902999 Bacteria 9438463
124 2689961694 2687453737 Bacteria 11203906
125 2753071644 2751185734 Bacteria 8863695
126 2774843726 2773857921 Bacteria 9435764
127 2791911277 2791354901 Bacteria 8322202
128 2870729396 2870721527 Bacteria 9689237
129 rootL2_10136155
130 Ga0070674_100119075
131 Ga0070713_100332534
132 Ga0070708_100005876
133 Ga0070663_100037954
134 Ga0070706_100015843
135 Ga0070706_100232434
136 Ga0070707_100005558
137 Ga0070707_100255190
138 Ga0070698_100023788
139 Ga0070698_100192366
140 Ga0070697_100058819
141 Ga0068853_100016641
142 Ga0068853_100066851
143 Ga0068855_100000878
144 Ga0068854_100117495
145 Ga0070702_100206104
146 Ga0068859_100000043
147 Ga0068862_100000009
148 Ga0070717_10049801
149 Ga0070716_100033982
150 Ga0075367_10040975
151 Ga0075366_10037763
152 Ga0075370_10019803
153 Ga0075430_100010936
154 Ga0075431_100035400
155 Ga0075431_100664670
156 Ga0075434_100051413
157 Ga0075429_100083225
158 Ga0068865_100267858
159 Ga0097620_100000043
160 Ga0075435_100138544
161 Ga0075435_100310654
162 Ga0111539_10021260
163 Ga0105245_10002136
164 Ga0105245_10423135
165 Ga0114129_10216720
166 Ga0114129_10467233
167 Ga0114129_10696886
168 Ga0105248_10000460
169 Ga0163162_10154894
170 Ga0163163_10002266
171 Ga0157377_10286512
172 Ga0207684_10171676
173 Ga0207687_10001921
174 Ga0207687_10302609
175 Ga0207669_10278495
176 Ga0207704_10250322
177 Ga0207711_10000314
178 Ga0207679_10042297
179 Ga0207667_10007666
180 Ga0207712_10006571
181 Ga0207640_10095530
182 Ga0207639_10011637
183 Ga0207678_10178350
184 Ga0207648_10244285
185 Ga0207698_10113432
186 Ga0268265_10000050
187 Ga0265324_10000041
188 Ga0265327_10051289
189 Ga0307408_100021111
190 Ga0307408_100233694
191 Ga0307514_10011432
192 Ga0307514_10177411
193 Ga0265314_10125556
194 Ga0265342_10109485
195 Ga0307516_10011882
196 Ga0307405_10029641
197 Ga0307410_10048715
198 Ga0307410_10316281
199 Ga0326468_10000191
200 Ga0307406_10009586
201 Ga0307406_10041897
202 Ga0307407_10023948
203 Ga0307412_10046172
204 Ga0307409_100005434
205 Ga0307409_100066725
206 Ga0307409_100246740
207 Ga0307416_100045840
208 Ga0307416_100290431
209 Ga0307414_10270769
210 Ga0307415_100096451
211 Ga0307415_100355788
212 Ga0307510_10026676
213 Ga0373951_0000032
214 Ga0395898_0002459
215 Ga0395898_0138960
216 Ga0395905_0582930
217 Ga0436364_0097256
218 Ga0436364_0291783
219 Ga0395901_0370506
220 Ga0436365_0230732
221 Ga0436362_0659285
222 Ga0451853_0871378
223 Ga0439443_026873
224 Ga0439448_0022265
225 Ga0439450_004369
226 Ga0439454_002289
227 Ga0439463_002179
228 Ga0450917_002725
229 Ga0450891_006617
230 Ga0450902_013044
231 Ga0439464_0000379
232 Ga0450901_011141
233 Ga0439440_0007835
234 Ga0466963_0220132
235 Ga0466967_0011738
236 Ga0496118_0059684
237 Ga0501034_0069169
238 Ga0501034_0285720
239 Ga0501036_0008008
240 Ga0501038_0020784
241 Ga0501035_0000670
242 nmdc:mga0k408_11025_c1
243 nmdc:mga06z11_11533_c1
244 nmdc:mga07m45_20231_c2
245 nmdc:mga05p37_25536_c1
246 nmdc:mga05p37_918221_c1
247 nmdc:mga06r32_71473_c1
248 nmdc:mga0n895_5756_c1
249 nmdc:mga0rr50_173153_c1
250 2508674421
251 2676199148
252 2689961694
253 2753071644
254 2774843726
255 2791911277
256 2870729396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

1

106

0.88

PF05368

NmrA

NmrA-like family

1

216

0.86

PF13460

NAD_binding_10

NAD(P)H-binding

3

180

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.8869 2 274
5l4l-assembly1.cif.gz_A polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 0.8698 1 281
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.8696 1 277
2vrb-assembly1.cif.gz_A-2 crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.8673 1 275
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.8663 2 274
ID Description Score Start End Superfamily
af_P39315_1_278_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9044 1 271 3.40.50.2300
af_P39315_137_283_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9 136 277 3.90.25.10
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8883 3 275 3.40.50.720
af_Q2G0Y0_1_192_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8832 2 171 3.40.50.720
af_A0A0R0HWA9_4_130_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8815 2 99 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0E4FWE7-F1-model_v4 NmrA-like domain-containing protein 0.9756 56 282
AF-A0A529SIZ2-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9674 2 96 GO:0006813
AF-A0A1M6TLP8-F1-model_v4 Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains 0.9599 1 281
AF-A0A0E4FWE7-F1-model_v4 NmrA-like domain-containing protein 0.959 56 282
AF-A0A365XVU3-F1-model_v4 NmrA-like domain-containing protein 0.9517 2 280

Map