F136717

General Info

Members Datasets Scaffolds Average Seq Length
128 110 256 456

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100040350|Ga0070683_1000403504
Length 489
Sequence MAAPCSAILGARRRRLIDKREILDLAAQTSLTPHVIEKDYVLGWVLAGIYAHEELAESWIFKGGTCLKKCFFETYRFSEDLDFTLRNESQLDEAFLKRVFADVGAWVYEETGIEIPLDQQEFDIYRNPRGNLSCQGKISYKGPVSPTRPLPRIKLDLTADERVVLPPETVEIFHPYSDAPEEGIEVLAYDYVEAFAEKFRALAERTRPRDLYDVVNLYRNTDARPEQQQFVAVLREKCAFKGIQLPQLADISLHRADVEAGWSGMLNHQLPALLPIGSFWDALPEIFGWLHGQVATTVLPAMPLMGGATAEIIRERIVGLPTGSRGQTFIETVRFAAANRLLVNLDYRDQQGRRSSRAIEAYSLRRSRAGDVLLMAVRAEDGQPRSYRLDSILGVSQTQTTFSPRYPIELTPTGLQSIPPTSRTAGIVTMQHSTRRRSRASAGGPTYVFRCTVCHKLFERKTYDGSLRPHKNRAGYQCYGTYGTHVRTK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
64 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
65 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
66 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
85 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
86 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
87 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
88 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
89 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
90 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
91 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
92 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
93 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
94 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
95 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
96 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
97 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
98 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
99 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
100 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
101 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
102 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
103 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
104 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
105 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
106 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
107 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
108 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
109 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
110 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.59
Metatranscriptomes 1.56
Isolates 14.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 7.03
Rhizoplane 0
Rhizosphere 67.97
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100040350 3300005329 Bacteria 4291
2 Ga0070658_10072941 3300005327 Bacteria 2814
3 Ga0070680_100004781 3300005336 Bacteria 10193
4 Ga0070680_100086230 3300005336 Unclassified 2595
5 Ga0070675_100023929 3300005354 Unclassified 4888
6 Ga0070709_10000429 3300005434 Bacteria 25465
7 Ga0070705_100001430 3300005440 Bacteria 12633
8 Ga0070708_100115456 3300005445 Bacteria 2471
9 Ga0070681_10063026 3300005458 Bacteria 3680
10 Ga0070681_10088586 3300005458 Bacteria 3046
11 Ga0070681_10119726 3300005458 Bacteria 2568
12 Ga0070679_100008846 3300005530 Bacteria 9502
13 Ga0070679_100075370 3300005530 Bacteria 3363
14 Ga0070679_100154957 3300005530 Bacteria 2266
15 Ga0070695_100047157 3300005545 Bacteria 2751
16 Ga0070696_100019851 3300005546 Bacteria 4555
17 Ga0068855_100009331 3300005563 Bacteria 11849
18 Ga0068852_100000096 3300005616 Bacteria 59611
19 Ga0068864_100005604 3300005618 Bacteria 10294
20 Ga0068858_100061750 3300005842 Unclassified 3465
21 Ga0081455_10001174 3300005937 Bacteria 32737
22 Ga0075366_10000179 3300006195 Bacteria 27619
23 Ga0075428_100040604 3300006844 Bacteria 5118
24 Ga0099794_10004149 3300007265 Bacteria 5647
25 Ga0105240_10000207 3300009093 Bacteria 119579
26 Ga0105240_10021906 3300009093 Bacteria 8488
27 Ga0114129_10252077 3300009147 Bacteria 2369
28 Ga0114129_10334816 3300009147 Bacteria 2009
29 Ga0105248_10037677 3300009177 Bacteria 5410
30 Ga0105237_10002914 3300009545 Bacteria 20729
31 Ga0105238_10019946 3300009551 Bacteria 6824
32 Ga0105238_10028614 3300009551 Bacteria 5677
33 Ga0105239_10010985 3300010375 Bacteria 10107
34 Ga0157370_10000057 3300013104 Bacteria 117332
35 Ga0157370_10005459 3300013104 Bacteria 14256
36 Ga0157369_10000098 3300013105 Bacteria 120936
37 Ga0157374_10033497 3300013296 Archaea 4687
38 Ga0157372_10000138 3300013307 Bacteria 79726
39 Ga0157372_10061280 3300013307 Bacteria 4212
40 Ga0157380_10002090 3300014326 Bacteria 13390
41 Ga0213876_10001368 3300021384 Bacteria 15266
42 Ga0224572_1001929 3300024225 Bacteria 3226
43 Ga0209233_1000233 3300025261 Bacteria 95855
44 Ga0209675_1000336 3300025291 Bacteria 40977
45 Ga0209257_1013218 3300025304 Bacteria 3704
46 Ga0207699_10000072 3300025906 Bacteria 81208
47 Ga0207684_10196332 3300025910 Bacteria 1741
48 Ga0207707_10032296 3300025912 Bacteria 4582
49 Ga0207707_10045602 3300025912 Bacteria 3820
50 Ga0207695_10000035 3300025913 Bacteria 486590
51 Ga0207671_10005399 3300025914 Bacteria 11784
52 Ga0207660_10000171 3300025917 Bacteria 41117
53 Ga0207660_10153897 3300025917 Bacteria 1769
54 Ga0207652_10012685 3300025921 Bacteria 6815
55 Ga0207652_10054349 3300025921 Bacteria 3442
56 Ga0207711_10036828 3300025941 Bacteria 4152
57 Ga0207667_10008894 3300025949 Bacteria 11886
58 Ga0207703_10077660 3300026035 Unclassified 2757
59 Ga0207676_10007315 3300026095 Bacteria 7828
60 Ga0207698_10000023 3300026142 Bacteria 126655
61 Ga0265356_1001754 3300028017 Bacteria 3082
62 Ga0265334_10013196 3300028573 Plasmid 3462
63 Ga0265318_10017306 3300028577 Unclassified 2961
64 Ga0265323_10002502 3300028653 Bacteria 8387
65 Ga0265323_10009950 3300028653 Bacteria 3865
66 Ga0307515_10156342 3300028794 Bacteria 2351
67 Ga0265338_10010384 3300028800 Bacteria 10926
68 Ga0265324_10018586 3300029957 Unclassified 2511
69 Ga0265762_1001942 3300030760 Bacteria 3755
70 Ga0265760_10004526 3300031090 Bacteria 3989
71 Ga0265325_10079355 3300031241 Bacteria 1633
72 Ga0265316_10015193 3300031344 Bacteria 6742
73 Ga0265342_10028063 3300031712 Bacteria 3510
74 Ga0307516_10000948 3300031730 Bacteria 40013
75 Ga0307510_10021279 3300033180 Bacteria 7559
76 Ga0307510_10125596 3300033180 Bacteria 2256
77 Ga0373927_0083954 3300035695 Unclassified 2065
78 Ga0400484_31258 3300038725 Bacteria 3205
79 Ga0400490_14568 3300038726 Bacteria 10042
80 Ga0400491_12021 3300038727 Bacteria 3533
81 Ga0400488_11984 3300038741 Bacteria 2787
82 Ga0436365_0831228 3300039437 Bacteria 10287
83 Ga0453684_0000063 3300044712 Bacteria 486079
84 Ga0453684_0067072 3300044712 Bacteria 4565
85 Ga0495592_0045234 3300046454 Bacteria 3286
86 Ga0495592_0162427 3300046454 Unclassified 1535
87 Ga0495629_0088552 3300046459 Bacteria 2159
88 Ga0495638_0001130 3300046460 Bacteria 25831
89 Ga0495582_0050684 3300046473 Bacteria 2288
90 Ga0495628_0005615 3300046516 Bacteria 10984
91 Ga0495628_0009722 3300046516 Bacteria 8204
92 Ga0495586_0087180 3300046535 Unclassified 1721
93 Ga0495635_0047317 3300046663 Bacteria 2967
94 Ga0495658_0036917 3300046683 Bacteria 2699
95 Ga0495613_0088395 3300046689 Bacteria 2245
96 Ga0495604_0000816 3300047317 Bacteria 26091
97 Ga0495674_0012618 3300047319 Bacteria 7961
98 Ga0495614_0081885 3300048089 Bacteria 1399
99 Ga0501044_0015198 3300049823 Bacteria 8292
100 nmdc:mga0k408_286_c1 3300050493 Bacteria 27552
101 nmdc:mga05p37_190285_c1 3300050507 Bacteria 2492
102 Ga0500578_0000067 3300053086 Bacteria 115659
103 Ga0500641_0001076 3300053096 Bacteria 9721
104 Ga0500650_0000163 3300053098 Bacteria 17394
105 Ga0500595_018997 3300053119 Bacteria 2501
106 Ga0500642_0066031 3300053130 Bacteria 1636
107 Ga0500655_004020 3300053133 Bacteria 2649
108 Ga0500590_007110 3300053148 Bacteria 5505
109 Ga0500622_0043892 3300053156 Bacteria 2317
110 2513914650 2513237144 Bacteria 7530820
111 2792750329 2791355123 Bacteria 8049106
112 2824618213 2824617872 Bacteria 8814715
113 2824627080 2824626560 Bacteria 8813858
114 2824635251 2824635225 Bacteria 8785348
115 2824644090 2824644064 Bacteria 8743947
116 2824704702 2824704595 Bacteria 9667483
117 2824714762 2824714736 Bacteria 8717648
118 2824724173 2824723954 Bacteria 8758240
119 2883292986 2883291878 Bacteria 5894118
120 2924737415 2924733363 Bacteria 7574837
121 2935638162 2935630451 Bacteria 8169952
122 2941514809 2941507105 Bacteria 8166816
123 2941522943 2941515067 Bacteria 8166720
124 2941530921 2941523033 Bacteria 8169134
125 3005482413 3005474847 Bacteria 9259049
126 8019564676 8019555841 Bacteria 9642137
127 8019574768 8019565922 Bacteria 9639779
128 8046773516 8046767195 Bacteria 7547379
129 Ga0070683_100040350
130 Ga0070658_10072941
131 Ga0070680_100004781
132 Ga0070680_100086230
133 Ga0070675_100023929
134 Ga0070709_10000429
135 Ga0070705_100001430
136 Ga0070708_100115456
137 Ga0070681_10063026
138 Ga0070681_10088586
139 Ga0070681_10119726
140 Ga0070679_100008846
141 Ga0070679_100075370
142 Ga0070679_100154957
143 Ga0070695_100047157
144 Ga0070696_100019851
145 Ga0068855_100009331
146 Ga0068852_100000096
147 Ga0068864_100005604
148 Ga0068858_100061750
149 Ga0081455_10001174
150 Ga0075366_10000179
151 Ga0075428_100040604
152 Ga0099794_10004149
153 Ga0105240_10000207
154 Ga0105240_10021906
155 Ga0114129_10252077
156 Ga0114129_10334816
157 Ga0105248_10037677
158 Ga0105237_10002914
159 Ga0105238_10019946
160 Ga0105238_10028614
161 Ga0105239_10010985
162 Ga0157370_10000057
163 Ga0157370_10005459
164 Ga0157369_10000098
165 Ga0157374_10033497
166 Ga0157372_10000138
167 Ga0157372_10061280
168 Ga0157380_10002090
169 Ga0213876_10001368
170 Ga0224572_1001929
171 Ga0209233_1000233
172 Ga0209675_1000336
173 Ga0209257_1013218
174 Ga0207699_10000072
175 Ga0207684_10196332
176 Ga0207707_10032296
177 Ga0207707_10045602
178 Ga0207695_10000035
179 Ga0207671_10005399
180 Ga0207660_10000171
181 Ga0207660_10153897
182 Ga0207652_10012685
183 Ga0207652_10054349
184 Ga0207711_10036828
185 Ga0207667_10008894
186 Ga0207703_10077660
187 Ga0207676_10007315
188 Ga0207698_10000023
189 Ga0265356_1001754
190 Ga0265334_10013196
191 Ga0265318_10017306
192 Ga0265323_10002502
193 Ga0265323_10009950
194 Ga0307515_10156342
195 Ga0265338_10010384
196 Ga0265324_10018586
197 Ga0265762_1001942
198 Ga0265760_10004526
199 Ga0265325_10079355
200 Ga0265316_10015193
201 Ga0265342_10028063
202 Ga0307516_10000948
203 Ga0307510_10021279
204 Ga0307510_10125596
205 Ga0373927_0083954
206 Ga0400484_31258
207 Ga0400490_14568
208 Ga0400491_12021
209 Ga0400488_11984
210 Ga0436365_0831228
211 Ga0453684_0000063
212 Ga0453684_0067072
213 Ga0495592_0045234
214 Ga0495592_0162427
215 Ga0495629_0088552
216 Ga0495638_0001130
217 Ga0495582_0050684
218 Ga0495628_0005615
219 Ga0495628_0009722
220 Ga0495586_0087180
221 Ga0495635_0047317
222 Ga0495658_0036917
223 Ga0495613_0088395
224 Ga0495604_0000816
225 Ga0495674_0012618
226 Ga0495614_0081885
227 Ga0501044_0015198
228 nmdc:mga0k408_286_c1
229 nmdc:mga05p37_190285_c1
230 Ga0500578_0000067
231 Ga0500641_0001076
232 Ga0500650_0000163
233 Ga0500595_018997
234 Ga0500642_0066031
235 Ga0500655_004020
236 Ga0500590_007110
237 Ga0500622_0043892
238 2513914650
239 2792750329
240 2824618213
241 2824627080
242 2824635251
243 2824644090
244 2824704702
245 2824714762
246 2824724173
247 2883292986
248 2924737415
249 2935638162
250 2941514809
251 2941522943
252 2941530921
253 3005482413
254 8019564676
255 8019574768
256 8046773516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13280

WYL

WYL domain

328

440

0.89

PF08843

AbiEii

Nucleotidyl transferase AbiEii toxin, Type IV TA system

44

286

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qfz-assembly4.cif.gz_H brxr, a wyl-domain containing transcriptional regulator 0.8751 313 384
7qfz-assembly4.cif.gz_G brxr, a wyl-domain containing transcriptional regulator 0.868 313 385
7qfz-assembly3.cif.gz_E brxr, a wyl-domain containing transcriptional regulator 0.8637 313 385
7u02-assembly1.cif.gz_M structure of the c. crescentus drid c-domain bound to ssdna 0.7582 280 383
1e0b-assembly1.cif.gz_A chromo shadow domain from fission yeast swi6 protein. 0.7551 344 370
ID Description Score Start End Superfamily
af_P40381_261_328_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7624 346 371 2.40.50.40
6ftoA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7482 342 370 2.40.50.40
1zq1B01 Mainly Beta;Roll;SH3 type barrels.; 0.7406 323 386 2.30.30.520
1e0bB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7273 344 370 2.40.50.40
af_G5EEY5_974_1195_2.30.30.490 Mainly Beta;Roll;SH3 type barrels.;Bromo adjacent homology (BAH) domain 0.715 325 376 2.30.30.490
ID Description Score Start End GO Terms
AF-A0A7C3CPW2-F1-model_v4 WYL domain-containing protein 0.988 313 391
AF-R7XY50-F1-model_v4 WYL domain-containing protein 0.9773 1 392
AF-R7XY50-F1-model_v4 WYL domain-containing protein 0.9748 1 392
AF-A0A2T6NQD8-F1-model_v4 WYL domain-containing protein 0.974 306 391
AF-A0A4R9XS61-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9639 1 200 GO:0016740

Map