F136457

General Info

Members Datasets Scaffolds Average Seq Length
128 70 256 245

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10009009|JGI25406J46586_100090094
Length 259
Sequence MLLRKMVQRKWLLTTILVLLGTALCIRLGIWQLDRLEGRRXFNAQIXTXRSLPXXDLNQEGVDAIDEMEWRAVQVNGTYDFENQIAIRNQYHENQYGYHLLTPLLFTPSTRPIGQSERDVTAVLIDRGWIPADGNSAPADWRKYDETGDVNVTGQIRLGQAKPAFGGVTDTLPENGARLEIWNNADITQIAKQLPYPILPVYIQPNPEVGDTEPPIPFQPEIELTEGPHFGYALQWFTFAVILFVGYPFFLRKQETSSK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
48 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
49 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
60 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
61 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
62 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
63 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
64 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
65 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
66 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
67 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
68 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
69 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
70 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 31.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009009 3300003203 Bacteria 4486
2 JGI25406J46586_10022349 3300003203 Bacteria 2522
3 Ga0065707_10000435 3300005295 Bacteria 91033
4 Ga0065707_10010487 3300005295 Bacteria 2108
5 Ga0065707_10095543 3300005295 Bacteria 3333
6 Ga0065707_10168174 3300005295 Bacteria 1505
7 Ga0070689_100055269 3300005340 Bacteria 3076
8 Ga0070687_100151308 3300005343 Bacteria 1362
9 Ga0070692_10358309 3300005345 Bacteria 908
10 Ga0070667_100625031 3300005367 Bacteria 993
11 Ga0070706_100159977 3300005467 Bacteria 2102
12 Ga0070698_100007381 3300005471 Bacteria 11896
13 Ga0070698_100034359 3300005471 Bacteria 5248
14 Ga0070698_100115269 3300005471 Bacteria 2652
15 Ga0070699_100008966 3300005518 Bacteria 8667
16 Ga0070699_100500084 3300005518 Unclassified 1104
17 Ga0070699_100607241 3300005518 Bacteria 998
18 Ga0070697_100217670 3300005536 Bacteria 1627
19 Ga0070695_100129213 3300005545 Bacteria 1739
20 Ga0070696_100188790 3300005546 Bacteria 1533
21 Ga0068857_100233571 3300005577 Viruses 1682
22 Ga0068859_100058163 3300005617 Bacteria 3894
23 Ga0068864_100088852 3300005618 Bacteria 2722
24 Ga0068861_100473333 3300005719 Unclassified 1127
25 Ga0068863_100199155 3300005841 Viruses 1926
26 Ga0068862_100036390 3300005844 Bacteria 4172
27 Ga0081539_10006401 3300005985 Bacteria 11324
28 Ga0075428_100055340 3300006844 Bacteria 4346
29 Ga0075428_100315095 3300006844 Bacteria 1681
30 Ga0075430_100268336 3300006846 Bacteria 1413
31 Ga0075430_100660409 3300006846 Unclassified 862
32 Ga0075431_100302501 3300006847 Unclassified 1615
33 Ga0075433_10184759 3300006852 Unclassified 1855
34 Ga0075429_100029119 3300006880 Bacteria 4797
35 Ga0075429_100078291 3300006880 Bacteria 2881
36 Ga0075429_100264260 3300006880 Bacteria 1507
37 Ga0075429_100515213 3300006880 Bacteria 1048
38 Ga0097620_100058163 3300006931 Bacteria 3894
39 Ga0111539_10014970 3300009094 Bacteria 9668
40 Ga0105245_10286504 3300009098 Unclassified 1612
41 Ga0114129_10004590 3300009147 Bacteria 19488
42 Ga0114129_10005503 3300009147 Bacteria 17907
43 Ga0114129_10134813 3300009147 Bacteria 3388
44 Ga0114129_10415749 3300009147 Unclassified 1770
45 Ga0114129_10419861 3300009147 Bacteria 1759
46 Ga0114129_10521822 3300009147 Unclassified 1548
47 Ga0105243_10031970 3300009148 Bacteria 4061
48 Ga0105243_10239087 3300009148 Unclassified 1615
49 Ga0105242_10293617 3300009176 Unclassified 1481
50 Ga0105249_10198658 3300009553 Unclassified 1961
51 Ga0105246_10234382 3300011119 Bacteria 1447
52 Ga0105246_10478510 3300011119 Bacteria 1053
53 Ga0207660_10223253 3300025917 Bacteria 1479
54 Ga0207646_10278547 3300025922 Bacteria 1511
55 Ga0207709_10042746 3300025935 Bacteria 2728
56 Ga0207709_10407345 3300025935 Unclassified 1041
57 Ga0207670_10060781 3300025936 Bacteria 2576
58 Ga0207641_10335303 3300026088 Unclassified 1438
59 Ga0207675_100176720 3300026118 Bacteria 2043
60 Ga0207675_101065854 3300026118 Unclassified 827
61 Ga0268265_10016371 3300028380 Bacteria 5091
62 Ga0268265_10038388 3300028380 Unclassified 3523
63 Ga0316579_10074415 3300031691 Bacteria 1613
64 Ga0316579_10128055 3300031691 Unclassified 1222
65 Ga0307410_10160945 3300031852 Bacteria 1682
66 Ga0307406_10124781 3300031901 Bacteria 1797
67 Ga0307407_10067644 3300031903 Unclassified 2112
68 Ga0307412_10535258 3300031911 Unclassified 981
69 Ga0307409_100064396 3300031995 Bacteria 2880
70 Ga0307415_100380472 3300032126 Bacteria 1198
71 Ga0373950_0004238 3300034818 Bacteria 2092
72 Ga0373941_0036790 3300035115 Unclassified 1491
73 Ga0373962_0157791 3300035242 Unclassified 747
74 Ga0316582_0110054 3300036647 Unclassified 1833
75 Ga0316584_0081157 3300036712 Bacteria 2429
76 Ga0451577_0001844 3300042876 Bacteria 27017
77 Ga0451577_0287985 3300042876 Unclassified 1488
78 Ga0451577_1128051 3300042876 Unclassified 701
79 Ga0453683_0015587 3300044673 Bacteria 4919
80 Ga0453683_0092307 3300044673 Unclassified 1898
81 Ga0453684_0000802 3300044712 Bacteria 107142
82 Ga0453684_0009512 3300044712 Bacteria 16993
83 Ga0453684_0018343 3300044712 Bacteria 10748
84 Ga0453684_0092716 3300044712 Bacteria 3722
85 Ga0453684_0097680 3300044712 Bacteria 3604
86 Ga0453684_0159793 3300044712 Bacteria 2666
87 Ga0453684_0207210 3300044712 Bacteria 2281
88 Ga0453684_0258040 3300044712 Bacteria 1998
89 Ga0453684_0304357 3300044712 Bacteria 1811
90 Ga0453684_0317156 3300044712 Bacteria 1767
91 Ga0453684_0332438 3300044712 Bacteria 1718
92 Ga0453684_0348525 3300044712 Unclassified 1670
93 Ga0453684_0875826 3300044712 Unclassified 963
94 Ga0451576_0051646 3300045051 Bacteria 4310
95 Ga0451576_0079175 3300045051 Bacteria 3419
96 Ga0451576_0218338 3300045051 Bacteria 1991
97 Ga0451576_0258535 3300045051 Bacteria 1820
98 Ga0451576_0813190 3300045051 Unclassified 981
99 Ga0451576_0912323 3300045051 Bacteria 922
100 Ga0501298_004233 3300049521 Bacteria 2253
101 Ga0501036_0330319 3300049572 Bacteria 1274
102 Ga0501048_0604783 3300049582 Unclassified 787
103 Ga0501074_0247966 3300049590 Bacteria 1266
104 Ga0501075_0032708 3300049591 Bacteria 3866
105 Ga0501075_0389694 3300049591 Unclassified 1062
106 Ga0501076_0013547 3300049592 Bacteria 6114
107 Ga0501076_0234576 3300049592 Unclassified 1500
108 Ga0501079_0030114 3300049741 Unclassified 4171
109 Ga0501081_0103534 3300049743 Unclassified 2014
110 Ga0501081_0326152 3300049743 Unclassified 1129
111 nmdc:mga05p37_110086_c1 3300050507 Bacteria 3388
112 nmdc:mga05p37_112151_c1 3300050507 Bacteria 3354
113 nmdc:mga05p37_1427749_c1 3300050507 Bacteria 695
114 nmdc:mga05p37_146833_c1 3300050507 Bacteria 2887
115 nmdc:mga05p37_156074_c1 3300050507 Unclassified 2789
116 nmdc:mga05p37_207467_c1 3300050507 Bacteria 2369
117 nmdc:mga05p37_210933_c1 3300050507 Bacteria 2348
118 nmdc:mga05p37_289577_c2 3300050507 Bacteria 1408
119 nmdc:mga09592_108102_c1 3300050508 Unclassified 2385
120 nmdc:mga09592_359716_c1 3300050508 Unclassified 1260
121 nmdc:mga09592_603675_c1 3300050508 Bacteria 940
122 nmdc:mga09592_84551_c1 3300050508 Unclassified 2706
123 nmdc:mga06r32_117565_c1 3300050510 Unclassified 2620
124 nmdc:mga0n895_278219_c1 3300050512 Unclassified 1697
125 nmdc:mga0a205_142294_c1 3300050515 Unclassified 2299
126 nmdc:mga0a205_446047_c1 3300050515 Bacteria 1154
127 Ga0501084_0232611 3300054114 Bacteria 1556
128 Ga0501082_0297679 3300060353 Bacteria 1405
129 JGI25406J46586_10009009
130 JGI25406J46586_10022349
131 Ga0065707_10000435
132 Ga0065707_10010487
133 Ga0065707_10095543
134 Ga0065707_10168174
135 Ga0070689_100055269
136 Ga0070687_100151308
137 Ga0070692_10358309
138 Ga0070667_100625031
139 Ga0070706_100159977
140 Ga0070698_100007381
141 Ga0070698_100034359
142 Ga0070698_100115269
143 Ga0070699_100008966
144 Ga0070699_100500084
145 Ga0070699_100607241
146 Ga0070697_100217670
147 Ga0070695_100129213
148 Ga0070696_100188790
149 Ga0068857_100233571
150 Ga0068859_100058163
151 Ga0068864_100088852
152 Ga0068861_100473333
153 Ga0068863_100199155
154 Ga0068862_100036390
155 Ga0081539_10006401
156 Ga0075428_100055340
157 Ga0075428_100315095
158 Ga0075430_100268336
159 Ga0075430_100660409
160 Ga0075431_100302501
161 Ga0075433_10184759
162 Ga0075429_100029119
163 Ga0075429_100078291
164 Ga0075429_100264260
165 Ga0075429_100515213
166 Ga0097620_100058163
167 Ga0111539_10014970
168 Ga0105245_10286504
169 Ga0114129_10004590
170 Ga0114129_10005503
171 Ga0114129_10134813
172 Ga0114129_10415749
173 Ga0114129_10419861
174 Ga0114129_10521822
175 Ga0105243_10031970
176 Ga0105243_10239087
177 Ga0105242_10293617
178 Ga0105249_10198658
179 Ga0105246_10234382
180 Ga0105246_10478510
181 Ga0207660_10223253
182 Ga0207646_10278547
183 Ga0207709_10042746
184 Ga0207709_10407345
185 Ga0207670_10060781
186 Ga0207641_10335303
187 Ga0207675_100176720
188 Ga0207675_101065854
189 Ga0268265_10016371
190 Ga0268265_10038388
191 Ga0316579_10074415
192 Ga0316579_10128055
193 Ga0307410_10160945
194 Ga0307406_10124781
195 Ga0307407_10067644
196 Ga0307412_10535258
197 Ga0307409_100064396
198 Ga0307415_100380472
199 Ga0373950_0004238
200 Ga0373941_0036790
201 Ga0373962_0157791
202 Ga0316582_0110054
203 Ga0316584_0081157
204 Ga0451577_0001844
205 Ga0451577_0287985
206 Ga0451577_1128051
207 Ga0453683_0015587
208 Ga0453683_0092307
209 Ga0453684_0000802
210 Ga0453684_0009512
211 Ga0453684_0018343
212 Ga0453684_0092716
213 Ga0453684_0097680
214 Ga0453684_0159793
215 Ga0453684_0207210
216 Ga0453684_0258040
217 Ga0453684_0304357
218 Ga0453684_0317156
219 Ga0453684_0332438
220 Ga0453684_0348525
221 Ga0453684_0875826
222 Ga0451576_0051646
223 Ga0451576_0079175
224 Ga0451576_0218338
225 Ga0451576_0258535
226 Ga0451576_0813190
227 Ga0451576_0912323
228 Ga0501298_004233
229 Ga0501036_0330319
230 Ga0501048_0604783
231 Ga0501074_0247966
232 Ga0501075_0032708
233 Ga0501075_0389694
234 Ga0501076_0013547
235 Ga0501076_0234576
236 Ga0501079_0030114
237 Ga0501081_0103534
238 Ga0501081_0326152
239 nmdc:mga05p37_110086_c1
240 nmdc:mga05p37_112151_c1
241 nmdc:mga05p37_1427749_c1
242 nmdc:mga05p37_146833_c1
243 nmdc:mga05p37_156074_c1
244 nmdc:mga05p37_207467_c1
245 nmdc:mga05p37_210933_c1
246 nmdc:mga05p37_289577_c2
247 nmdc:mga09592_108102_c1
248 nmdc:mga09592_359716_c1
249 nmdc:mga09592_603675_c1
250 nmdc:mga09592_84551_c1
251 nmdc:mga06r32_117565_c1
252 nmdc:mga0n895_278219_c1
253 nmdc:mga0a205_142294_c1
254 nmdc:mga0a205_446047_c1
255 Ga0501084_0232611
256 Ga0501082_0297679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02104

SURF1

SURF1 family

19

241

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6h-assembly1.cif.gz_Dw cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.5705 21 246
3afq-assembly1.cif.gz_D crystal structure of the single-stranded dna binding protein from mycobacterium leprae (form ii) 0.5597 67 152
3a5u-assembly1.cif.gz_B-2 promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex 0.5584 67 152
7w5z-assembly1.cif.gz_h cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.5558 19 240
3k8a-assembly1.cif.gz_A neisseria gonorrhoeae prib 0.5436 67 153
ID Description Score Start End Superfamily
3k8aA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5436 67 153 2.40.50.140
af_Q4DK95_262_395_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5146 67 166 2.40.50.140
4dniA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4977 67 165 2.40.50.140
af_Q9VF30_249_404_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4812 84 170 2.40.50.140
af_Q4CR04_76_206_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4812 67 165 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7Y4RMG4-F1-model_v4 SURF1-like protein 0.9216 1 248 GO:0005886
AF-A0A1F8R3X7-F1-model_v4 SURF1-like protein 0.913 1 253 GO:0005886
AF-A0A7Y4RMG4-F1-model_v4 SURF1-like protein 0.9107 1 248 GO:0005886
AF-A0A419E5M3-F1-model_v4 SURF1-like protein 0.9063 2 249 GO:0005886
AF-A0A3D0CSR4-F1-model_v4 SURF1-like protein 0.8997 4 252 GO:0005886

Map