F136257

General Info

Members Datasets Scaffolds Average Seq Length
127 97 112 247

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954721474|2954730276
Length 269
Sequence GRQGKPLAPCGCVADIDDITITTCAERPELISRVYEIRENWPAFMLHDAVGNALFNRVAEDFPDYCVVATEGDRVIARGRSAPFNASLPGREELPAQGWDRVMVWAFSDLHRNRPTTTASALDITIDTDYLGRGLSHRMLMALRDAVGQQGIRSLLAPVRPTAKHLQPSLPMTDYIGQQQDDGLPTDPWLRVHIKAGAVIEKVAPASMTISGSLAEWRRWTGLPFDRDGDVVVPGALVPVHCDTAHDHAVYVEPNVWVRHGLTPASNHA

Samples

Sample ID Description Type Environment
1 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
2 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
3 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
4 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
5 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
6 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
7 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
8 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
9 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
10 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
11 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
12 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
44 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
45 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
48 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
49 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
50 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
55 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
56 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
59 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
76 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
97 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.19
Metatranscriptomes 0
Isolates 11.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0
Rhizoplane 11.02
Rhizosphere 63.78
Stem 0
Stem Tuber 0
Unclassified 13.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10107788 3300003320 Bacteria 2420
2 rootL2_10060207 3300003322 Bacteria 2799
3 Ga0070678_100159140 3300005456 Bacteria 1828
4 Ga0068856_100981111 3300005614 Bacteria 863
5 Ga0068859_100266142 3300005617 Bacteria 1806
6 Ga0068859_100443582 3300005617 Bacteria 1394
7 Ga0081455_10222916 3300005937 Bacteria 1396
8 Ga0070717_10051583 3300006028 Bacteria 3386
9 Ga0075365_10122463 3300006038 Bacteria 1795
10 Ga0075363_100055099 3300006048 Bacteria 2129
11 Ga0075363_100144578 3300006048 Bacteria 1340
12 Ga0075364_10015731 3300006051 Bacteria 4696
13 Ga0075364_10074125 3300006051 Bacteria 2244
14 Ga0075364_10132298 3300006051 Bacteria 1675
15 Ga0075367_10011134 3300006178 Bacteria 4746
16 Ga0075367_10038994 3300006178 Bacteria 2768
17 Ga0075367_10181200 3300006178 Bacteria 1313
18 Ga0075428_100001203 3300006844 Bacteria 27710
19 Ga0075428_100014645 3300006844 Bacteria 8709
20 Ga0075430_100360897 3300006846 Bacteria 1200
21 Ga0097620_100266146 3300006931 Bacteria 1806
22 Ga0097620_100443528 3300006931 Bacteria 1394
23 Ga0114129_10002278 3300009147 Bacteria 26562
24 Ga0114129_11097667 3300009147 Bacteria 996
25 Ga0105238_10186503 3300009551 Bacteria 2051
26 Ga0105239_10171582 3300010375 Bacteria 2425
27 Ga0157372_10493035 3300013307 Bacteria 1428
28 Ga0157375_10137513 3300013308 Bacteria 2568
29 Ga0157375_10478932 3300013308 Bacteria 1410
30 Ga0207702_10383442 3300026078 Bacteria 1352
31 Ga0207702_10908260 3300026078 Bacteria 873
32 Ga0207683_10064945 3300026121 Bacteria 3217
33 Ga0307515_10156684 3300028794 Bacteria 2346
34 Ga0307513_10353298 3300031456 Bacteria 1217
35 Ga0307408_100162631 3300031548 Bacteria 1774
36 Ga0307405_10004637 3300031731 Bacteria 6526
37 Ga0307406_10187997 3300031901 Bacteria 1510
38 Ga0307412_10021779 3300031911 Bacteria 3920
39 Ga0307409_100000186 3300031995 Bacteria 24240
40 Ga0307409_100735774 3300031995 Bacteria 989
41 Ga0307416_100604617 3300032002 Bacteria 1177
42 Ga0436364_1305429 3300037853 Bacteria 2923
43 Ga0400483_064729 3300039062 Bacteria 9146
44 Ga0400483_285567 3300039062 Bacteria 9359
45 Ga0451791_1618623 3300041451 Bacteria 1828
46 Ga0451841_1006046 3300041498 Bacteria 795
47 Ga0451853_3979869 3300041512 Bacteria 2333
48 Ga0495662_0295505 3300046476 Bacteria 797
49 Ga0495608_0245181 3300046511 Bacteria 1118
50 Ga0495645_0032984 3300046543 Bacteria 3777
51 Ga0495613_0482224 3300046689 Bacteria 837
52 Ga0496102_0038366 3300048905 Bacteria 4323
53 Ga0496104_0002676 3300048907 Bacteria 15332
54 Ga0496105_0007087 3300048908 Bacteria 8642
55 Ga0496107_0373848 3300048910 Unclassified 1060
56 Ga0496108_0001004 3300048911 Bacteria 22017
57 Ga0496108_0050520 3300048911 Bacteria 3481
58 Ga0496109_0012866 3300048912 Bacteria 7232
59 Ga0496109_0020490 3300048912 Bacteria 5841
60 Ga0496109_0023813 3300048912 Bacteria 5435
61 Ga0496110_0001228 3300048913 Bacteria 18270
62 Ga0496110_0071998 3300048913 Bacteria 3066
63 Ga0496111_0004135 3300048914 Bacteria 9118
64 Ga0496113_0039003 3300048916 Bacteria 3495
65 Ga0496124_0472259 3300048927 Bacteria 849
66 Ga0496125_0025610 3300048928 Bacteria 5398
67 Ga0501031_0002564 3300049568 Bacteria 11577
68 Ga0501031_0528153 3300049568 Bacteria 760
69 Ga0501032_0005953 3300049569 Bacteria 9005
70 Ga0501033_0001267 3300049570 Bacteria 22572
71 Ga0501034_0005864 3300049571 Bacteria 13355
72 Ga0501034_0098989 3300049571 Bacteria 2911
73 Ga0501036_0006958 3300049572 Bacteria 9200
74 Ga0501036_0200779 3300049572 Bacteria 1677
75 Ga0501036_0785898 3300049572 Bacteria 784
76 Ga0501037_0001631 3300049573 Bacteria 16300
77 Ga0501038_0015417 3300049574 Bacteria 6947
78 Ga0501039_0003053 3300049575 Bacteria 12519
79 Ga0501039_0512995 3300049575 Bacteria 941
80 Ga0501039_0679705 3300049575 Bacteria 805
81 Ga0501040_0013854 3300049576 Bacteria 5308
82 Ga0501040_0482722 3300049576 Unclassified 893
83 Ga0501043_0050521 3300049579 Bacteria 3268
84 Ga0501046_0004562 3300049580 Bacteria 12536
85 Ga0501047_0085173 3300049581 Bacteria 3036
86 Ga0501048_0000335 3300049582 Bacteria 32394
87 Ga0501068_0029095 3300049584 Bacteria 3271
88 Ga0501069_0005967 3300049585 Bacteria 6355
89 Ga0501070_0001700 3300049586 Bacteria 19499
90 Ga0501070_0383238 3300049586 Bacteria 1139
91 Ga0501071_0054946 3300049587 Bacteria 2874
92 Ga0501073_0024410 3300049589 Bacteria 4342
93 Ga0501074_0005694 3300049590 Bacteria 8980
94 Ga0501076_0320520 3300049592 Bacteria 1271
95 Ga0501080_0001432 3300049742 Bacteria 20045
96 Ga0501035_0013182 3300049822 Bacteria 7629
97 Ga0501035_0014516 3300049822 Bacteria 7270
98 Ga0501044_0082790 3300049823 Bacteria 3246
99 nmdc:mga03n38_3319_c1 3300050490 Bacteria 5149
100 nmdc:mga00v17_20844_c1 3300050491 Bacteria 3761
101 nmdc:mga00v17_70196_c1 3300050491 Bacteria 2169
102 nmdc:mga07m45_58438_c1 3300050496 Bacteria 2182
103 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
104 nmdc:mga09592_2_c1 3300050508 Bacteria 168133
105 nmdc:mga0qj67_57_c1 3300050509 Bacteria 27021
106 nmdc:mga06r32_22_c2 3300050510 Bacteria 39510
107 nmdc:mga06r32_429404_c1 3300050510 Bacteria 1302
108 nmdc:mga06r32_89321_c1 3300050510 Bacteria 3008
109 nmdc:mga0n895_325949_c1 3300050512 Bacteria 1556
110 Ga0500644_0000410 3300053088 Bacteria 20195
111 Ga0500616_0000223 3300053153 Bacteria 88492
112 Ga0501084_0039380 3300054114 Bacteria 3953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0295505 Ga0495662_0295505_124_780 217
2 3300041498 Ga0451841_1006046 Ga0451841_1006046_79_762 226
3 3300049572 Ga0501036_0785898 Ga0501036_0785898_83_766 226
4 3300006048 Ga0075363_100144578 Ga0075363_1001445783 227
5 3300049568 Ga0501031_0528153 Ga0501031_0528153_35_727 229
6 3300046511 Ga0495608_0245181 Ga0495608_0245181_203_898 230
7 3300048927 Ga0496124_0472259 Ga0496124_0472259_42_737 230
8 iso_pu_bacteria 2884693830 2884694893 240
9 iso_pu_bacteria 2895442618 2895446412 240
10 3300006844 Ga0075428_100014645 Ga0075428_1000146451 241
11 3300050510 nmdc:mga06r32_429404_c1 nmdc:mga06r32_429404_c1_370_1098 241
12 3300005617 Ga0068859_100266142 Ga0068859_1002661422 242
13 3300006931 Ga0097620_100266146 Ga0097620_1002661462 242
14 3300050512 nmdc:mga0n895_325949_c1 nmdc:mga0n895_325949_c1_570_1301 242
15 3300053088 Ga0500644_0000410 Ga0500644_0000410_8458_9189 242
16 iso_pu_bacteria 2861520306 2861528189 242
17 iso_pu_bacteria 2868088558 2868093090 242
18 iso_pu_bacteria 2891326441 2891328587 242
19 3300005614 Ga0068856_100981111 Ga0068856_1009811111 243
20 3300006178 Ga0075367_10181200 Ga0075367_101812002 243
21 3300006846 Ga0075430_100360897 Ga0075430_1003608972 243
22 3300009147 Ga0114129_11097667 Ga0114129_110976671 243
23 3300026078 Ga0207702_10908260 Ga0207702_109082601 243
24 3300041451 Ga0451791_1618623 Ga0451791_1618623_480_1214 243
25 3300041512 Ga0451853_3979869 Ga0451853_3979869_319_1053 243
26 3300048910 Ga0496107_0373848 Ga0496107_0373848_252_986 243
27 3300048911 Ga0496108_0050520 Ga0496108_0050520_480_1214 243
28 3300048912 Ga0496109_0020490 Ga0496109_0020490_4922_5656 243
29 3300048913 Ga0496110_0071998 Ga0496110_0071998_1854_2588 243
30 3300049587 Ga0501071_0054946 Ga0501071_0054946_1814_2548 243
31 iso_pu_bacteria 2675903060 2676494541 243
32 iso_pu_bacteria 8054107350 8054108272 243
33 iso_pu_bacteria 8057568493 8057570976 243
34 3300006038 Ga0075365_10122463 Ga0075365_101224632 244
35 3300006048 Ga0075363_100055099 Ga0075363_1000550992 244
36 3300006051 Ga0075364_10074125 Ga0075364_100741255 244
37 3300006178 Ga0075367_10011134 Ga0075367_100111342 244
38 3300006178 Ga0075367_10038994 Ga0075367_100389942 244
39 3300049823 Ga0501044_0082790 Ga0501044_0082790_803_1537 244
40 3300050490 nmdc:mga03n38_3319_c1 nmdc:mga03n38_3319_c1_1221_1958 244
41 3300050491 nmdc:mga00v17_20844_c1 nmdc:mga00v17_20844_c1_2858_3595 244
42 3300050491 nmdc:mga00v17_70196_c1 nmdc:mga00v17_70196_c1_1402_2139 244
43 3300050496 nmdc:mga07m45_58438_c1 nmdc:mga07m45_58438_c1_1227_1964 244
44 3300006051 Ga0075364_10015731 Ga0075364_100157314 245
45 3300049572 Ga0501036_0200779 Ga0501036_0200779_570_1313 245
46 3300049575 Ga0501039_0679705 Ga0501039_0679705_28_771 245
47 3300049576 Ga0501040_0482722 Ga0501040_0482722_62_802 245
48 3300049586 Ga0501070_0383238 Ga0501070_0383238_92_832 245
49 3300049592 Ga0501076_0320520 Ga0501076_0320520_346_1086 245
50 3300005937 Ga0081455_10222916 Ga0081455_102229162 246
51 3300006051 Ga0075364_10132298 Ga0075364_101322983 246
52 3300009551 Ga0105238_10186503 Ga0105238_101865032 246
53 3300010375 Ga0105239_10171582 Ga0105239_101715823 246
54 3300013307 Ga0157372_10493035 Ga0157372_104930351 246
55 3300013308 Ga0157375_10478932 Ga0157375_104789322 246
56 3300026078 Ga0207702_10383442 Ga0207702_103834422 246
57 3300028794 Ga0307515_10156684 Ga0307515_101566842 246
58 3300031456 Ga0307513_10353298 Ga0307513_103532981 246
59 3300037853 Ga0436364_1305429 Ga0436364_1305429_649_1392 246
60 3300046689 Ga0495613_0482224 Ga0495613_0482224_66_806 246
61 3300048928 Ga0496125_0025610 Ga0496125_0025610_3052_3801 246
62 3300049568 Ga0501031_0002564 Ga0501031_0002564_10348_11088 246
63 3300049569 Ga0501032_0005953 Ga0501032_0005953_2379_3119 246
64 3300049570 Ga0501033_0001267 Ga0501033_0001267_21781_22521 246
65 3300049571 Ga0501034_0005864 Ga0501034_0005864_11521_12261 246
66 3300049572 Ga0501036_0006958 Ga0501036_0006958_7804_8544 246
67 3300049573 Ga0501037_0001631 Ga0501037_0001631_2171_2911 246
68 3300049574 Ga0501038_0015417 Ga0501038_0015417_3639_4379 246
69 3300049575 Ga0501039_0003053 Ga0501039_0003053_2588_3328 246
70 3300049576 Ga0501040_0013854 Ga0501040_0013854_507_1247 246
71 3300049579 Ga0501043_0050521 Ga0501043_0050521_2039_2779 246
72 3300049580 Ga0501046_0004562 Ga0501046_0004562_9028_9768 246
73 3300049581 Ga0501047_0085173 Ga0501047_0085173_1558_2298 246
74 3300049582 Ga0501048_0000335 Ga0501048_0000335_21099_21839 246
75 3300049584 Ga0501068_0029095 Ga0501068_0029095_1002_1742 246
76 3300049585 Ga0501069_0005967 Ga0501069_0005967_5501_6241 246
77 3300049586 Ga0501070_0001700 Ga0501070_0001700_15296_16036 246
78 3300049589 Ga0501073_0024410 Ga0501073_0024410_1095_1835 246
79 3300049590 Ga0501074_0005694 Ga0501074_0005694_6014_6754 246
80 3300049742 Ga0501080_0001432 Ga0501080_0001432_11425_12165 246
81 3300049822 Ga0501035_0013182 Ga0501035_0013182_1003_1743 246
82 3300050510 nmdc:mga06r32_89321_c1 nmdc:mga06r32_89321_c1_996_1736 246
83 3300054114 Ga0501084_0039380 Ga0501084_0039380_1002_1742 246
84 3300013308 Ga0157375_10137513 Ga0157375_101375132 247
85 3300031995 Ga0307409_100735774 Ga0307409_1007357741 247
86 3300032002 Ga0307416_100604617 Ga0307416_1006046171 247
87 3300048905 Ga0496102_0038366 Ga0496102_0038366_1088_1834 247
88 3300048907 Ga0496104_0002676 Ga0496104_0002676_12603_13349 247
89 3300048908 Ga0496105_0007087 Ga0496105_0007087_6430_7176 247
90 3300048911 Ga0496108_0001004 Ga0496108_0001004_2708_3454 247
91 3300048912 Ga0496109_0012866 Ga0496109_0012866_2231_2977 247
92 3300048913 Ga0496110_0001228 Ga0496110_0001228_2934_3680 247
93 3300048914 Ga0496111_0004135 Ga0496111_0004135_7769_8515 247
94 3300048916 Ga0496113_0039003 Ga0496113_0039003_1838_2584 247
95 3300049575 Ga0501039_0512995 Ga0501039_0512995_156_905 247
96 3300053153 Ga0500616_0000223 Ga0500616_0000223_58117_58866 247
97 3300005456 Ga0070678_100159140 Ga0070678_1001591402 248
98 3300006028 Ga0070717_10051583 Ga0070717_100515835 248
99 3300026121 Ga0207683_10064945 Ga0207683_100649453 248
100 3300031901 Ga0307406_10187997 Ga0307406_101879972 248
101 3300039062 Ga0400483_064729 Ga0400483_064729_683_1435 249
102 3300039062 Ga0400483_285567 Ga0400483_285567_4326_5078 249
103 3300005617 Ga0068859_100443582 Ga0068859_1004435822 250
104 3300006844 Ga0075428_100001203 Ga0075428_10000120315 250
105 3300006931 Ga0097620_100443528 Ga0097620_1004435282 250
106 3300009147 Ga0114129_10002278 Ga0114129_1000227811 250
107 3300050507 nmdc:mga05p37_24_c1 nmdc:mga05p37_24_c1_73752_74510 250
108 3300050508 nmdc:mga09592_2_c1 nmdc:mga09592_2_c1_14458_15216 250
109 3300050509 nmdc:mga0qj67_57_c1 nmdc:mga0qj67_57_c1_11414_12172 250
110 3300050510 nmdc:mga06r32_22_c2 nmdc:mga06r32_22_c2_14458_15216 250
111 iso_pu_bacteria 2616644941 2616903451 250
112 iso_pu_bacteria 2954711539 2954720524 250
113 iso_pu_bacteria 2954721474 2954730074 250
114 iso_pu_bacteria 2954740390 2954748792 250
115 iso_pu_bacteria 2954749733 2954750672 250
116 3300031548 Ga0307408_100162631 Ga0307408_1001626312 251
117 3300031731 Ga0307405_10004637 Ga0307405_100046376 251
118 3300031911 Ga0307412_10021779 Ga0307412_100217793 251
119 3300031995 Ga0307409_100000186 Ga0307409_10000018612 251
120 3300049822 Ga0501035_0014516 Ga0501035_0014516_1880_2641 253
121 iso_pu_bacteria 2997600082 2997607118 253
122 3300003320 rootH2_10107788 rootH2_101077882 254
123 3300003322 rootL2_10060207 rootL2_100602072 254
124 3300046543 Ga0495645_0032984 Ga0495645_0032984_60_845 254
125 3300048912 Ga0496109_0023813 Ga0496109_0023813_4462_5229 254
126 3300049571 Ga0501034_0098989 Ga0501034_0098989_1350_2117 254
127 iso_pu_bacteria 2954721474 2954730276 254

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.843 54 147
2q4y-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex 0.8303 105 143
4oll-assembly1.cif.gz_A camp-binding acyltransferase from mycobacterium smegmatis 0.7772 54 148
2ree-assembly2.cif.gz_B crystal structure of the loading gnatl domain of cura from lyngbya majuscula 0.7701 7 251
7uci-assembly2.cif.gz_B sxta methyltransferase and decarboxylase didomain in complex with mn2+ and sah 0.7571 6 251
ID Description Score Start End Superfamily
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8673 54 147 3.40.630.30
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8379 53 151 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8216 54 148 3.40.630.30
2aj6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8189 54 133 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8176 106 154 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6G3U2M6-F1-model_v4 N-acetyltransferase 0.9917 8 249 GO:0016740
AF-D7C812-F1-model_v4 N-acetyltransferase domain-containing protein 0.989 83 249
AF-A0A1E7KPC3-F1-model_v4 Acetyltransferase-like protein 0.9889 7 249 GO:0016747
AF-A0A6G9FIW2-F1-model_v4 N-acetyltransferase 0.9887 7 250 GO:0016740
AF-A0A7X0GI65-F1-model_v4 GNAT superfamily N-acetyltransferase 0.9882 34 250 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map