F136204

General Info

Members Datasets Scaffolds Average Seq Length
127 38 254 119

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2740891818|2740994387
Length 133
Sequence IKLEVVTPEKAVVSEEVKIVMAPGADGEFGVLSGHTPFLSSLNVGILRYEDTSGTERVVFVSGGFAEALPDRVTVLAESAERKEDVDADRARAALLRAEKRLEGDRGGDLNVGRAKDALKRAMIRLQVSAARI

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
8 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
9 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
10 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
11 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
14 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
15 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
16 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
17 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
18 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
24 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
27 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
28 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
29 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
30 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
31 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
32 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
33 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
34 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
35 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
36 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 59.06
Metatranscriptomes 40.16
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 64.57
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100691836 3300005344 Bacteria 830
2 Ga0070714_100179307 3300005435 Bacteria 1927
3 Ga0070714_100587298 3300005435 Bacteria 1069
4 Ga0070713_100185930 3300005436 Bacteria 1870
5 Ga0070710_10104749 3300005437 Bacteria 1690
6 Ga0070710_10284582 3300005437 Bacteria 1074
7 Ga0070681_10636095 3300005458 Bacteria 982
8 Ga0068857_101156981 3300005577 Bacteria 748
9 Ga0070717_11934857 3300006028 Bacteria 532
10 Ga0075431_101698827 3300006847 Bacteria 588
11 Ga0157369_10920421 3300013105 Bacteria 896
12 Ga0213874_10131957 3300021377 Bacteria 858
13 Ga0207649_10666667 3300025920 Bacteria 805
14 Ga0207700_10309980 3300025928 Bacteria 1365
15 Ga0316575_10195261 3300031665 Unclassified 842
16 Ga0316576_10008418 3300031727 Bacteria 6577
17 Ga0316576_10246780 3300031727 Bacteria 1341
18 Ga0316576_10743818 3300031727 Bacteria 708
19 Ga0316576_11116938 3300031727 Bacteria 559
20 Ga0316578_10052587 3300031728 Bacteria 2387
21 Ga0316577_10030155 3300031733 Bacteria 3028
22 Ga0307416_102691933 3300032002 Bacteria 594
23 Ga0316593_10013845 3300032168 Bacteria 2395
24 Ga0316593_10028946 3300032168 Bacteria 1788
25 Ga0316593_10030141 3300032168 Bacteria 1759
26 Ga0316593_10071389 3300032168 Bacteria 1201
27 Ga0316593_10159179 3300032168 Bacteria 824
28 Ga0316593_10196253 3300032168 Bacteria 745
29 Ga0316593_10204353 3300032168 Bacteria 731
30 Ga0316593_10205915 3300032168 Bacteria 728
31 Ga0316593_10268706 3300032168 Unclassified 641
32 Ga0316592_1017280 3300033524 Bacteria 1513
33 Ga0316592_1030264 3300033524 Bacteria 1176
34 Ga0316592_1048531 3300033524 Bacteria 946
35 Ga0316592_1090678 3300033524 Bacteria 699
36 Ga0316592_1104675 3300033524 Bacteria 652
37 Ga0316592_1107943 3300033524 Unclassified 643
38 Ga0316592_1107952 3300033524 Bacteria 643
39 Ga0316592_1139544 3300033524 Unclassified 568
40 Ga0316592_1148949 3300033524 Bacteria 551
41 Ga0316592_1165503 3300033524 Unclassified 525
42 Ga0316592_1175651 3300033524 Bacteria 511
43 Ga0316588_1001689 3300033528 Bacteria 3696
44 Ga0316588_1004527 3300033528 Bacteria 2641
45 Ga0316588_1010840 3300033528 Bacteria 1931
46 Ga0316588_1011243 3300033528 Bacteria 1904
47 Ga0316588_1014154 3300033528 Bacteria 1742
48 Ga0316588_1036685 3300033528 Bacteria 1164
49 Ga0316588_1038065 3300033528 Bacteria 1145
50 Ga0316588_1060309 3300033528 Bacteria 925
51 Ga0316588_1137217 3300033528 Bacteria 624
52 Ga0316587_1001232 3300033529 Bacteria 3077
53 Ga0316587_1051196 3300033529 Unclassified 757
54 Ga0316587_1114067 3300033529 Bacteria 526
55 Ga0316596_1000503 3300033541 Bacteria 6679
56 Ga0316596_1000695 3300033541 Bacteria 6109
57 Ga0316596_1006064 3300033541 Bacteria 2794
58 Ga0316596_1013767 3300033541 Bacteria 1999
59 Ga0316596_1033051 3300033541 Bacteria 1347
60 Ga0316596_1044000 3300033541 Bacteria 1176
61 Ga0316596_1051149 3300033541 Bacteria 1093
62 Ga0316596_1062100 3300033541 Bacteria 997
63 Ga0316596_1076380 3300033541 Bacteria 899
64 Ga0316596_1086262 3300033541 Bacteria 845
65 Ga0316596_1089856 3300033541 Unclassified 828
66 Ga0316596_1094769 3300033541 Bacteria 805
67 Ga0316596_1097532 3300033541 Bacteria 794
68 Ga0316596_1110417 3300033541 Bacteria 746
69 Ga0316596_1116184 3300033541 Bacteria 727
70 Ga0316596_1166877 3300033541 Bacteria 607
71 Ga0316596_1168809 3300033541 Bacteria 604
72 Ga0316596_1170097 3300033541 Unclassified 601
73 Ga0316596_1173787 3300033541 Unclassified 595
74 Ga0316582_0122642 3300036647 Bacteria 1740
75 Ga0316582_0476180 3300036647 Bacteria 860
76 Ga0316584_0004784 3300036712 Bacteria 8985
77 Ga0316584_0017044 3300036712 Bacteria 5215
78 Ga0316584_0506749 3300036712 Bacteria 847
79 Ga0395905_1132584 3300037471 Bacteria 686
80 Ga0400484_13201 3300038725 Bacteria 19026
81 Ga0400484_39403 3300038725 Bacteria 7333
82 Ga0400490_07927 3300038726 Bacteria 1184
83 Ga0400490_17477 3300038726 Bacteria 12227
84 Ga0400490_17685 3300038726 Bacteria 2466
85 Ga0400490_19665 3300038726 Bacteria 1046
86 Ga0400490_28451 3300038726 Bacteria 5119
87 Ga0400491_09805 3300038727 Bacteria 3737
88 Ga0400491_29039 3300038727 Bacteria 4773
89 Ga0400485_05263 3300038735 Bacteria 14872
90 Ga0400485_06814 3300038735 Bacteria 9503
91 Ga0400485_06862 3300038735 Bacteria 13025
92 Ga0400485_10734 3300038735 Bacteria 19448
93 Ga0400485_12536 3300038735 Bacteria 1054
94 Ga0400488_27347 3300038741 Bacteria 3797
95 Ga0400488_33714 3300038741 Bacteria 2350
96 Ga0400488_44578 3300038741 Bacteria 1758
97 Ga0400486_00428 3300038742 Bacteria 12899
98 Ga0400486_15129 3300038742 Bacteria 20499
99 Ga0400486_29351 3300038742 Bacteria 18068
100 Ga0400486_30434 3300038742 Bacteria 24381
101 Ga0400486_32933 3300038742 Bacteria 22254
102 Ga0400483_020139 3300039062 Bacteria 2498
103 Ga0400483_026728 3300039062 Bacteria 2337
104 Ga0400483_110982 3300039062 Bacteria 1917
105 Ga0400483_157799 3300039062 Bacteria 5522
106 Ga0400483_207881 3300039062 Bacteria 1011
107 Ga0400483_234236 3300039062 Bacteria 2654
108 Ga0400483_243621 3300039062 Bacteria 2606
109 Ga0400483_253507 3300039062 Bacteria 1588
110 Ga0400483_281265 3300039062 Bacteria 4046
111 Ga0400489_24901 3300039093 Bacteria 9097
112 Ga0400489_29745 3300039093 Bacteria 20820
113 Ga0400489_83783 3300039093 Bacteria 5097
114 Ga0400489_92815 3300039093 Bacteria 6567
115 Ga0400487_03172 3300039110 Bacteria 3331
116 Ga0400487_06609 3300039110 Bacteria 1451
117 Ga0400487_13350 3300039110 Bacteria 1040
118 Ga0400487_29046 3300039110 Bacteria 2569
119 Ga0400487_35575 3300039110 Bacteria 2430
120 Ga0400487_57973 3300039110 Bacteria 1320
121 Ga0400487_59404 3300039110 Bacteria 16546
122 Ga0436363_0046849 3300039450 Bacteria 991
123 Ga0451577_0007998 3300042876 Bacteria 10323
124 Ga0453684_0002726 3300044712 Bacteria 41828
125 Ga0453684_0165741 3300044712 Bacteria 2609
126 Ga0453684_0357271 3300044712 Bacteria 1646
127 2740994387 2740891818 Bacteria 6711283
128 Ga0070661_100691836
129 Ga0070714_100179307
130 Ga0070714_100587298
131 Ga0070713_100185930
132 Ga0070710_10104749
133 Ga0070710_10284582
134 Ga0070681_10636095
135 Ga0068857_101156981
136 Ga0070717_11934857
137 Ga0075431_101698827
138 Ga0157369_10920421
139 Ga0213874_10131957
140 Ga0207649_10666667
141 Ga0207700_10309980
142 Ga0316575_10195261
143 Ga0316576_10008418
144 Ga0316576_10246780
145 Ga0316576_10743818
146 Ga0316576_11116938
147 Ga0316578_10052587
148 Ga0316577_10030155
149 Ga0307416_102691933
150 Ga0316593_10013845
151 Ga0316593_10028946
152 Ga0316593_10030141
153 Ga0316593_10071389
154 Ga0316593_10159179
155 Ga0316593_10196253
156 Ga0316593_10204353
157 Ga0316593_10205915
158 Ga0316593_10268706
159 Ga0316592_1017280
160 Ga0316592_1030264
161 Ga0316592_1048531
162 Ga0316592_1090678
163 Ga0316592_1104675
164 Ga0316592_1107943
165 Ga0316592_1107952
166 Ga0316592_1139544
167 Ga0316592_1148949
168 Ga0316592_1165503
169 Ga0316592_1175651
170 Ga0316588_1001689
171 Ga0316588_1004527
172 Ga0316588_1010840
173 Ga0316588_1011243
174 Ga0316588_1014154
175 Ga0316588_1036685
176 Ga0316588_1038065
177 Ga0316588_1060309
178 Ga0316588_1137217
179 Ga0316587_1001232
180 Ga0316587_1051196
181 Ga0316587_1114067
182 Ga0316596_1000503
183 Ga0316596_1000695
184 Ga0316596_1006064
185 Ga0316596_1013767
186 Ga0316596_1033051
187 Ga0316596_1044000
188 Ga0316596_1051149
189 Ga0316596_1062100
190 Ga0316596_1076380
191 Ga0316596_1086262
192 Ga0316596_1089856
193 Ga0316596_1094769
194 Ga0316596_1097532
195 Ga0316596_1110417
196 Ga0316596_1116184
197 Ga0316596_1166877
198 Ga0316596_1168809
199 Ga0316596_1170097
200 Ga0316596_1173787
201 Ga0316582_0122642
202 Ga0316582_0476180
203 Ga0316584_0004784
204 Ga0316584_0017044
205 Ga0316584_0506749
206 Ga0395905_1132584
207 Ga0400484_13201
208 Ga0400484_39403
209 Ga0400490_07927
210 Ga0400490_17477
211 Ga0400490_17685
212 Ga0400490_19665
213 Ga0400490_28451
214 Ga0400491_09805
215 Ga0400491_29039
216 Ga0400485_05263
217 Ga0400485_06814
218 Ga0400485_06862
219 Ga0400485_10734
220 Ga0400485_12536
221 Ga0400488_27347
222 Ga0400488_33714
223 Ga0400488_44578
224 Ga0400486_00428
225 Ga0400486_15129
226 Ga0400486_29351
227 Ga0400486_30434
228 Ga0400486_32933
229 Ga0400483_020139
230 Ga0400483_026728
231 Ga0400483_110982
232 Ga0400483_157799
233 Ga0400483_207881
234 Ga0400483_234236
235 Ga0400483_243621
236 Ga0400483_253507
237 Ga0400483_281265
238 Ga0400489_24901
239 Ga0400489_29745
240 Ga0400489_83783
241 Ga0400489_92815
242 Ga0400487_03172
243 Ga0400487_06609
244 Ga0400487_13350
245 Ga0400487_29046
246 Ga0400487_35575
247 Ga0400487_57973
248 Ga0400487_59404
249 Ga0436363_0046849
250 Ga0451577_0007998
251 Ga0453684_0002726
252 Ga0453684_0165741
253 Ga0453684_0357271
254 2740994387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

1

80

0.99

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

84

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9573 4 134
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9445 10 80
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9433 4 134
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9393 4 134
5awi-assembly1.cif.gz_B domain-swapped cytochrome cb562 dimer 0.9343 89 129
ID Description Score Start End Superfamily
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 1.001 90 132 1.20.5.440
6nchB01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9792 91 124 6.10.250.1120
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9713 3 89 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9688 3 89 2.60.15.10
2v7qH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9663 90 129 1.20.5.440
ID Description Score Start End GO Terms
AF-A6DUD6-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.99 4 86 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A4Q0IW75-F1-model_v4 ATP synthase F1 subunit epsilon 0.9881 4 73 GO:0012505
GO:0045261
GO:0046933
AF-A0A7W0NUT7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9865 5 82 GO:0012505
GO:0045261
GO:0046933
AF-A0A6L7WQJ0-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9864 3 75 GO:0012505
GO:0045261
GO:0046933
AF-A0A1F9MAU4-F1-model_v4 ATP synthase F1 subunit epsilon 0.9857 5 80 GO:0012505
GO:0045261
GO:0046933

Map