F134960

General Info

Members Datasets Scaffolds Average Seq Length
127 79 254 229

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100756235|Ga0307416_1007562351
Length 267
Sequence MDNELRDARRTVGRARAREEAEQAERTTGAAERAAVLRVHTIHGTSGPRRFLLENGLSLVSFALFAVTLVGLVLTGAAEYSQDQLEHGQAAVSVAEYLRTGAFVEALTENWESEFLQMGIFVLLTAKLYQRGSAESKHLEEPEQSDADPRVHRDDPEAPWPVRAGGLPLAVYKHSLSLALMLMFVVSFALHAVGGAREYSEEQREHGGQPVTALQYVVSSRFWFESFQNWQSEFLSVGVLVLLTIGLREQGSSQSKPVAAPSRETGH

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
59 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
64 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
65 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
66 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
69 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
70 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
71 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
72 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
73 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
74 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
75 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
76 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
77 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
78 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
79 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 0
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100756235 3300032002 Bacteria 1065
2 JGI24739J22299_10003554 3300001989 Bacteria 5957
3 JGI24737J22298_10000922 3300001990 Bacteria 10448
4 JGI24735J21928_10001106 3300002067 Bacteria 9667
5 JGI25153J46596_10017995 3300003215 Bacteria 2761
6 JGI25407J50210_10056096 3300003373 Bacteria 993
7 JGI25407J50210_10085408 3300003373 Bacteria 783
8 Ga0070670_100114045 3300005331 Bacteria 2330
9 Ga0070670_100249002 3300005331 Bacteria 1548
10 Ga0070675_100089517 3300005354 Bacteria 2577
11 Ga0070688_100224931 3300005365 Bacteria 1324
12 Ga0070663_100002774 3300005455 Bacteria 9930
13 Ga0070662_100000172 3300005457 Bacteria 37802
14 Ga0070679_100424982 3300005530 Bacteria 1274
15 Ga0068855_100036694 3300005563 Bacteria 5831
16 Ga0068857_100001801 3300005577 Bacteria 17237
17 Ga0068854_100002498 3300005578 Bacteria 11404
18 Ga0068852_100059941 3300005616 Bacteria 3303
19 Ga0068851_10002910 3300005834 Bacteria 7561
20 Ga0081455_10066454 3300005937 Bacteria 3011
21 Ga0081455_10159980 3300005937 Bacteria 1727
22 Ga0081538_10004308 3300005981 Bacteria 13154
23 Ga0081538_10009301 3300005981 Bacteria 8221
24 Ga0081538_10038393 3300005981 Bacteria 3090
25 Ga0075428_100047613 3300006844 Bacteria 4708
26 Ga0075428_100201455 3300006844 Bacteria 2152
27 Ga0075428_100227391 3300006844 Bacteria 2014
28 Ga0075428_100466497 3300006844 Bacteria 1352
29 Ga0075430_100006103 3300006846 Bacteria 10160
30 Ga0075430_100035898 3300006846 Bacteria 4204
31 Ga0075430_100073193 3300006846 Bacteria 2874
32 Ga0075430_100106340 3300006846 Bacteria 2341
33 Ga0075430_100124501 3300006846 Unclassified 2149
34 Ga0075430_100162074 3300006846 Bacteria 1861
35 Ga0075430_100333986 3300006846 Bacteria 1252
36 Ga0075430_100410954 3300006846 Bacteria 1117
37 Ga0075431_100000638 3300006847 Bacteria 29650
38 Ga0075431_100054096 3300006847 Bacteria 4139
39 Ga0075431_100057170 3300006847 Bacteria 4023
40 Ga0075431_100082828 3300006847 Bacteria 3312
41 Ga0075431_100093383 3300006847 Plasmid 3105
42 Ga0075429_100057533 3300006880 Bacteria 3385
43 Ga0105240_10026572 3300009093 Bacteria 7596
44 Ga0111539_10003715 3300009094 Bacteria 20083
45 Ga0111539_10013672 3300009094 Bacteria 10141
46 Ga0111539_10786962 3300009094 Bacteria 1107
47 Ga0114129_10228530 3300009147 Bacteria 2507
48 Ga0114129_10303181 3300009147 Bacteria 2128
49 Ga0114129_10385650 3300009147 Bacteria 1849
50 Ga0105243_10215744 3300009148 Bacteria 1693
51 Ga0105237_10000701 3300009545 Bacteria 46447
52 Ga0105029_102332 3300009984 Bacteria 1232
53 Ga0163162_11237463 3300013306 Bacteria 848
54 Ga0182005_1000326 3300015265 Bacteria 28190
55 Ga0209758_1002818 3300025297 Bacteria 16919
56 Ga0207656_10001594 3300025321 Bacteria 7545
57 Ga0207647_10004577 3300025904 Bacteria 10246
58 Ga0207695_10004041 3300025913 Bacteria 20186
59 Ga0207671_10000050 3300025914 Bacteria 190479
60 Ga0207650_10780535 3300025925 Bacteria 809
61 Ga0207659_10116411 3300025926 Bacteria 2041
62 Ga0207706_10000106 3300025933 Bacteria 88479
63 Ga0207669_10157907 3300025937 Bacteria 1598
64 Ga0207667_10000125 3300025949 Bacteria 118155
65 Ga0207640_10003304 3300025981 Bacteria 8699
66 Ga0207678_10048641 3300026067 Bacteria 3665
67 Ga0207674_10004296 3300026116 Bacteria 17186
68 Ga0207698_10043004 3300026142 Bacteria 3381
69 Ga0207428_10126008 3300027907 Bacteria 1961
70 Ga0307408_100007084 3300031548 Bacteria 7420
71 Ga0307408_100743680 3300031548 Bacteria 885
72 Ga0307405_10150110 3300031731 Bacteria 1637
73 Ga0307413_10005994 3300031824 Bacteria 5500
74 Ga0307413_10266629 3300031824 Bacteria 1280
75 Ga0307413_10495169 3300031824 Bacteria 980
76 Ga0307410_10002120 3300031852 Bacteria 9423
77 Ga0307410_10417596 3300031852 Bacteria 1087
78 Ga0307406_10271533 3300031901 Bacteria 1288
79 Ga0307407_10000365 3300031903 Bacteria 13609
80 Ga0307412_10026428 3300031911 Bacteria 3608
81 Ga0307409_100028103 3300031995 Bacteria 4000
82 Ga0307409_100112166 3300031995 Bacteria 2289
83 Ga0307416_100280351 3300032002 Bacteria 1643
84 Ga0307411_10057577 3300032005 Bacteria 2568
85 Ga0307411_10200748 3300032005 Bacteria 1531
86 Ga0307415_100004139 3300032126 Bacteria 7480
87 Ga0395901_0743197 3300038443 Unclassified 975
88 Ga0450910_001070 3300042147 Bacteria 3352
89 Ga0439459_0000981 3300042438 Bacteria 4048
90 Ga0451577_0278362 3300042876 Bacteria 1516
91 Ga0453684_0000019 3300044712 Bacteria 908702
92 Ga0495638_0000142 3300046460 Bacteria 113893
93 Ga0496121_0007287 3300048924 Bacteria 13384
94 Ga0501290_001776 3300049513 Bacteria 2871
95 Ga0501073_0549119 3300049589 Bacteria 798
96 Ga0501207_049642 3300049654 Bacteria 747
97 Ga0501080_0071961 3300049742 Unclassified 3217
98 Ga0501265_000964 3300049762 Bacteria 3238
99 Ga0501275_000338 3300049772 Bacteria 5330
100 nmdc:mga05p37_105247_c1 3300050507 Bacteria 3471
101 nmdc:mga05p37_149841_c1 3300050507 Bacteria 2854
102 nmdc:mga05p37_250913_c1 3300050507 Bacteria 2123
103 nmdc:mga05p37_58000_c1 3300050507 Bacteria 4768
104 nmdc:mga09592_503401_c1 3300050508 Bacteria 1043
105 nmdc:mga0qj67_154021_c1 3300050509 Bacteria 1865
106 nmdc:mga0qj67_268064_c1 3300050509 Bacteria 1385
107 nmdc:mga0qj67_338237_c1 3300050509 Bacteria 1218
108 nmdc:mga0qj67_372214_c1 3300050509 Bacteria 1154
109 nmdc:mga0qj67_57029_c1 3300050509 Bacteria 3097
110 nmdc:mga0qj67_86616_c1 3300050509 Bacteria 2513
111 nmdc:mga0qj67_93620_c1 3300050509 Bacteria 2416
112 nmdc:mga06r32_1805_c1 3300050510 Bacteria 19169
113 nmdc:mga06r32_21157_c1 3300050510 Bacteria 6003
114 nmdc:mga06r32_308218_c1 3300050510 Bacteria 1569
115 nmdc:mga06r32_689778_c1 3300050510 Bacteria 987
116 nmdc:mga06r32_740467_c1 3300050510 Bacteria 947
117 nmdc:mga06r32_83698_c1 3300050510 Plasmid 3109
118 nmdc:mga06r32_99209_c1 3300050510 Bacteria 2856
119 nmdc:mga08y16_18560_c1 3300050511 Bacteria 7328
120 nmdc:mga08y16_262215_c1 3300050511 Bacteria 1784
121 nmdc:mga08y16_49787_c1 3300050511 Bacteria 4384
122 Ga0500556_0000146 3300053104 Bacteria 59309
123 Ga0500604_0085916 3300053151 Bacteria 1022
124 Ga0500616_0008581 3300053153 Bacteria 6328
125 2919539970 2919538618 Bacteria 4677069
126 2919542293 2919538618 Bacteria 4677069
127 8054110420 8054107350 Bacteria 5022511
128 Ga0307416_100756235
129 JGI24739J22299_10003554
130 JGI24737J22298_10000922
131 JGI24735J21928_10001106
132 JGI25153J46596_10017995
133 JGI25407J50210_10056096
134 JGI25407J50210_10085408
135 Ga0070670_100114045
136 Ga0070670_100249002
137 Ga0070675_100089517
138 Ga0070688_100224931
139 Ga0070663_100002774
140 Ga0070662_100000172
141 Ga0070679_100424982
142 Ga0068855_100036694
143 Ga0068857_100001801
144 Ga0068854_100002498
145 Ga0068852_100059941
146 Ga0068851_10002910
147 Ga0081455_10066454
148 Ga0081455_10159980
149 Ga0081538_10004308
150 Ga0081538_10009301
151 Ga0081538_10038393
152 Ga0075428_100047613
153 Ga0075428_100201455
154 Ga0075428_100227391
155 Ga0075428_100466497
156 Ga0075430_100006103
157 Ga0075430_100035898
158 Ga0075430_100073193
159 Ga0075430_100106340
160 Ga0075430_100124501
161 Ga0075430_100162074
162 Ga0075430_100333986
163 Ga0075430_100410954
164 Ga0075431_100000638
165 Ga0075431_100054096
166 Ga0075431_100057170
167 Ga0075431_100082828
168 Ga0075431_100093383
169 Ga0075429_100057533
170 Ga0105240_10026572
171 Ga0111539_10003715
172 Ga0111539_10013672
173 Ga0111539_10786962
174 Ga0114129_10228530
175 Ga0114129_10303181
176 Ga0114129_10385650
177 Ga0105243_10215744
178 Ga0105237_10000701
179 Ga0105029_102332
180 Ga0163162_11237463
181 Ga0182005_1000326
182 Ga0209758_1002818
183 Ga0207656_10001594
184 Ga0207647_10004577
185 Ga0207695_10004041
186 Ga0207671_10000050
187 Ga0207650_10780535
188 Ga0207659_10116411
189 Ga0207706_10000106
190 Ga0207669_10157907
191 Ga0207667_10000125
192 Ga0207640_10003304
193 Ga0207678_10048641
194 Ga0207674_10004296
195 Ga0207698_10043004
196 Ga0207428_10126008
197 Ga0307408_100007084
198 Ga0307408_100743680
199 Ga0307405_10150110
200 Ga0307413_10005994
201 Ga0307413_10266629
202 Ga0307413_10495169
203 Ga0307410_10002120
204 Ga0307410_10417596
205 Ga0307406_10271533
206 Ga0307407_10000365
207 Ga0307412_10026428
208 Ga0307409_100028103
209 Ga0307409_100112166
210 Ga0307416_100280351
211 Ga0307411_10057577
212 Ga0307411_10200748
213 Ga0307415_100004139
214 Ga0395901_0743197
215 Ga0450910_001070
216 Ga0439459_0000981
217 Ga0451577_0278362
218 Ga0453684_0000019
219 Ga0495638_0000142
220 Ga0496121_0007287
221 Ga0501290_001776
222 Ga0501073_0549119
223 Ga0501207_049642
224 Ga0501080_0071961
225 Ga0501265_000964
226 Ga0501275_000338
227 nmdc:mga05p37_105247_c1
228 nmdc:mga05p37_149841_c1
229 nmdc:mga05p37_250913_c1
230 nmdc:mga05p37_58000_c1
231 nmdc:mga09592_503401_c1
232 nmdc:mga0qj67_154021_c1
233 nmdc:mga0qj67_268064_c1
234 nmdc:mga0qj67_338237_c1
235 nmdc:mga0qj67_372214_c1
236 nmdc:mga0qj67_57029_c1
237 nmdc:mga0qj67_86616_c1
238 nmdc:mga0qj67_93620_c1
239 nmdc:mga06r32_1805_c1
240 nmdc:mga06r32_21157_c1
241 nmdc:mga06r32_308218_c1
242 nmdc:mga06r32_689778_c1
243 nmdc:mga06r32_740467_c1
244 nmdc:mga06r32_83698_c1
245 nmdc:mga06r32_99209_c1
246 nmdc:mga08y16_18560_c1
247 nmdc:mga08y16_262215_c1
248 nmdc:mga08y16_49787_c1
249 Ga0500556_0000146
250 Ga0500604_0085916
251 Ga0500616_0008581
252 2919539970
253 2919542293
254 8054110420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20554

DUF6766

Domain of unknown function (DUF6766)

48

267

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oo6-assembly3.cif.gz_G complex of human nuclear cap-binding complex with ars2 c-terminal peptide 0.2983 111 192
7v2c-assembly1.cif.gz_m active state complex i from q10 dataset 0.2926 66 207
7v2c-assembly1.cif.gz_m active state complex i from q10 dataset 0.2141 66 207
4ons-assembly1.cif.gz_A structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin complex formation 0.1945 29 198
4ons-assembly1.cif.gz_A structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin complex formation 0.16 29 198
ID Description Score Start End Superfamily
af_Q5PNU0_396_543_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.4731 36 155 3.90.1420.10
af_Q7TR95_20_305_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3642 118 201 1.20.1070.10
af_Q92367_68_515_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3593 118 208 1.20.1740.10
af_Q6NQP5_8_210_1.20.58.1030 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.315 116 216 1.20.58.1030
af_Q5PNU0_396_543_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.3097 36 155 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A544VQY3-F1-model_v4 Transmembrane protein 0.9479 2 216 GO:0016020
AF-A0A2T6DCS3-F1-model_v4 Transmembrane protein 0.9455 7 216 GO:0016020
AF-A0A178IK78-F1-model_v4 VanZ-like domain-containing protein 0.9396 7 216
AF-A0A544VQY3-F1-model_v4 Transmembrane protein 0.9394 2 216 GO:0016020
AF-A0A3R7EGX9-F1-model_v4 deleted 0.9391 7 216

Map