F133520

General Info

Members Datasets Scaffolds Average Seq Length
127 102 254 991

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100005156|Ga0070697_1000051564
Length 1029
Sequence MTCGTRFLARLSSLMVGAALVLGGAPAPLAAQGQATTGIIRGVVTDPNGAPVANATVILHEGQTNFTRTLTTDAAGNFTGTLLPLGTYDVTARSVGYAEVKRTGIALGVGETVHLPLPLAAVTLAAVXVEATQPVVNVTQSAAATPLSAAAVTGLPNNGRNFINLTLLTPNVAIVQGPDGDELTVAGQRGIHNNVSVDGADFNNSFFGEQRGGQRPAFTFNLDAVHELVVVAGGANAEFGRSSGGFVNVITKSGTNETKGSLHYFGKFDAVSGTPEHTSPSGQITRFTPDFSQNQFGFTLGGPLKRDRIFYFLAYDQQIYDDVKQKTRPSSPQLDSLKTFLTARYPELANDFGPISRTNDARAALAKFDFRLSDRHNLSLKYNYTWAQQKNGTFDVDTWGASANGLEQSHSHAVNGSLVSFLSSRTSNEFRFQFAREDRPRPYTGPNNHLGDTTGVSSIFGAAAPFHDTDIDPTQAFRIGLPFFLPIRDDHDTRVQLLNNLSISRGNHLIKFGGEWNRTSTTQVFVGFAGGRMAFSSVHGFENFVNQGSHYIECSDGTSGRFPGFNCTAPATITGPVLLYLQQSGVGSTTVEQAGTQTLTQNELAVFLQDTWKPSAKLTLNYGLRWEAQIEPDPITPPSQVFFAPWIDSTVVNARGRFTFPSDGTIPSDKKMWQPRFGLAWDPNADGRQVLRLSAGMYYARIPGLNLASVRSTNGSLGQTLFGSSGTVGFLPPPAFDSLLPLSTGTPFQPTVYVVDRDFQNPRTINLTAGYERQVARDLAASISYTHARGDHLTRFINRNDPAFGSPFGSGPRAIGTLFSVESSAKSRYNGITVGLRRVLDPNLQFDVNYTLSFDKSDDDNERDPFTFRYAQVDSLGKEYNWSDRDQRHRFNGWLLAKVFGFYFNNRVSYYSAQPASASCGPRTGNLFAPPAGARAVSTADRICADGHILQRNTIRKDNAYFSWDIRIERPFPGGPRGRLEAMIEVFNVTNADNFKDPAAGTNFLNFDGTIRSGLGDPRQLQAGIRWVF

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100005156 3300005536 Bacteria 10035
2 Ga0070670_100000085 3300005331 Bacteria 89017
3 Ga0070680_100035451 3300005336 Bacteria 4028
4 Ga0068868_100000167 3300005338 Bacteria 43141
5 Ga0070689_100021860 3300005340 Bacteria 4770
6 Ga0070687_100018132 3300005343 Unclassified 3249
7 Ga0070675_100000019 3300005354 Bacteria 173624
8 Ga0070703_10000643 3300005406 Bacteria 12254
9 Ga0070714_100008335 3300005435 Bacteria 8085
10 Ga0070711_100000635 3300005439 Bacteria 18322
11 Ga0070711_100004512 3300005439 Bacteria 8228
12 Ga0070705_100003556 3300005440 Bacteria 7630
13 Ga0070694_100002724 3300005444 Bacteria 10487
14 Ga0070694_100021701 3300005444 Unclassified 4108
15 Ga0070708_100000224 3300005445 Bacteria 42021
16 Ga0070708_100025738 3300005445 Bacteria 5032
17 Ga0070685_10002774 3300005466 Bacteria 8958
18 Ga0070706_100030066 3300005467 Bacteria 5003
19 Ga0070706_100061082 3300005467 Unclassified 3479
20 Ga0070707_100000794 3300005468 Bacteria 31216
21 Ga0070707_100060562 3300005468 Bacteria 3630
22 Ga0070699_100006734 3300005518 Bacteria 9991
23 Ga0070699_100021755 3300005518 Bacteria 5527
24 Ga0070699_100059907 3300005518 Bacteria 3298
25 Ga0070697_100021188 3300005536 Bacteria 5148
26 Ga0068853_100062813 3300005539 Bacteria 3215
27 Ga0070695_100004385 3300005545 Bacteria 8279
28 Ga0070695_100010000 3300005545 Bacteria 5657
29 Ga0070696_100006656 3300005546 Bacteria 7719
30 Ga0070696_100033740 3300005546 Bacteria 3519
31 Ga0070704_100001118 3300005549 Bacteria 13957
32 Ga0070704_100001246 3300005549 Bacteria 13412
33 Ga0070704_100026546 3300005549 Bacteria 3828
34 Ga0068855_100004784 3300005563 Bacteria 16524
35 Ga0068857_100019473 3300005577 Bacteria 5960
36 Ga0068854_100003708 3300005578 Bacteria 9553
37 Ga0068870_10010795 3300005840 Bacteria 4210
38 Ga0068858_100000130 3300005842 Bacteria 78543
39 Ga0075428_100027468 3300006844 Bacteria 6297
40 Ga0075431_100004758 3300006847 Bacteria 13348
41 Ga0075433_10015419 3300006852 Bacteria 6267
42 Ga0075434_100027318 3300006871 Bacteria 5602
43 Ga0075429_100022551 3300006880 Bacteria 5458
44 Ga0075435_100001742 3300007076 Bacteria 14161
45 Ga0105244_10003323 3300009036 Bacteria 11581
46 Ga0111539_10000033 3300009094 Bacteria 154510
47 Ga0105245_10002776 3300009098 Bacteria 15754
48 Ga0114129_10045555 3300009147 Bacteria 6166
49 Ga0105242_10002186 3300009176 Bacteria 15438
50 Ga0105239_10082775 3300010375 Bacteria 3534
51 Ga0163162_10006425 3300013306 Bacteria 11382
52 Ga0157372_10003242 3300013307 Bacteria 17588
53 Ga0207653_10000126 3300025885 Bacteria 54271
54 Ga0207699_10006753 3300025906 Bacteria 5573
55 Ga0207643_10014919 3300025908 Bacteria 4226
56 Ga0207684_10003398 3300025910 Bacteria 15585
57 Ga0207684_10058651 3300025910 Unclassified 3267
58 Ga0207663_10000516 3300025916 Bacteria 16934
59 Ga0207663_10026420 3300025916 Bacteria 3370
60 Ga0207662_10027880 3300025918 Unclassified 3262
61 Ga0207646_10003071 3300025922 Bacteria 19203
62 Ga0207646_10041205 3300025922 Bacteria 4153
63 Ga0207650_10000035 3300025925 Bacteria 215488
64 Ga0207659_10000001 3300025926 Bacteria 660958
65 Ga0207687_10001169 3300025927 Bacteria 17912
66 Ga0207687_10015256 3300025927 Bacteria 5034
67 Ga0207700_10041322 3300025928 Bacteria 3373
68 Ga0207686_10006998 3300025934 Bacteria 6069
69 Ga0207670_10000798 3300025936 Bacteria 16472
70 Ga0207640_10001102 3300025981 Bacteria 14926
71 Ga0207677_10000230 3300026023 Bacteria 43746
72 Ga0207703_10036221 3300026035 Bacteria 3926
73 Ga0207639_10000013 3300026041 Bacteria 293084
74 Ga0207708_10009995 3300026075 Bacteria 7045
75 Ga0207641_10022986 3300026088 Bacteria 5136
76 Ga0207674_10030136 3300026116 Bacteria 5707
77 Ga0207675_100010123 3300026118 Bacteria 8837
78 Ga0209970_1000525 3300027614 Bacteria 6585
79 Ga0209588_1002683 3300027671 Bacteria 4854
80 Ga0209971_1000330 3300027682 Bacteria 13087
81 Ga0209998_10002047 3300027717 Bacteria 4725
82 Ga0209974_10000468 3300027876 Bacteria 13421
83 Ga0207428_10000001 3300027907 Bacteria 1034622
84 Ga0268265_10036807 3300028380 Bacteria 3587
85 Ga0307511_10002839 3300030521 Bacteria 17997
86 Ga0307410_10006014 3300031852 Bacteria 6504
87 Ga0307410_10022624 3300031852 Bacteria 3889
88 Ga0307406_10016090 3300031901 Bacteria 4339
89 Ga0307412_10020647 3300031911 Unclassified 4012
90 Ga0307409_100019291 3300031995 Unclassified 4612
91 Ga0307416_100001617 3300032002 Bacteria 12393
92 Ga0307411_10001144 3300032005 Bacteria 10394
93 Ga0307415_100003435 3300032126 Bacteria 8058
94 Ga0373936_0000043 3300035113 Bacteria 87319
95 Ga0373961_0000372 3300035241 Bacteria 19254
96 Ga0373947_0015595 3300035725 Bacteria 4365
97 Ga0373925_0017350 3300037068 Bacteria 5217
98 Ga0395905_0067857 3300037471 Bacteria 3341
99 Ga0451577_0001689 3300042876 Bacteria 28478
100 Ga0453683_0006165 3300044673 Bacteria 8256
101 Ga0453683_0041590 3300044673 Unclassified 2887
102 Ga0453684_0000330 3300044712 Bacteria 198124
103 Ga0451576_0009214 3300045051 Bacteria 11472
104 Ga0451576_0013465 3300045051 Bacteria 9149
105 Ga0451576_0025166 3300045051 Bacteria 6416
106 Ga0451576_0027183 3300045051 Bacteria 6146
107 Ga0451576_0039729 3300045051 Bacteria 4981
108 Ga0495580_0004968 3300046472 Bacteria 11110
109 Ga0495580_0035570 3300046472 Bacteria 3581
110 Ga0495620_0000335 3300046515 Bacteria 32783
111 Ga0495684_0033900 3300047471 Unclassified 3917
112 Ga0496108_0000799 3300048911 Bacteria 24565
113 Ga0496109_0000316 3300048912 Bacteria 45455
114 Ga0496112_0000406 3300048915 Bacteria 28243
115 Ga0496113_0002332 3300048916 Bacteria 10971
116 Ga0501068_0012712 3300049584 Bacteria 4779
117 Ga0501073_0005712 3300049589 Bacteria 9309
118 Ga0501081_0044539 3300049743 Bacteria 3046
119 nmdc:mga09592_3555_c1 3300050508 Bacteria 12585
120 nmdc:mga06r32_16799_c1 3300050510 Bacteria 6672
121 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
122 nmdc:mga0n895_3546_c1 3300050512 Bacteria 12626
123 nmdc:mga0rr50_4329_c1 3300050513 Bacteria 8326
124 nmdc:mga08x19_40179_c1 3300050514 Bacteria 2976
125 nmdc:mga0a205_26759_c1 3300050515 Bacteria 5504
126 nmdc:mga0a205_357_c1 3300050515 Bacteria 34582
127 nmdc:mga0a205_5167_c1 3300050515 Bacteria 11736
128 Ga0070697_100005156
129 Ga0070670_100000085
130 Ga0070680_100035451
131 Ga0068868_100000167
132 Ga0070689_100021860
133 Ga0070687_100018132
134 Ga0070675_100000019
135 Ga0070703_10000643
136 Ga0070714_100008335
137 Ga0070711_100000635
138 Ga0070711_100004512
139 Ga0070705_100003556
140 Ga0070694_100002724
141 Ga0070694_100021701
142 Ga0070708_100000224
143 Ga0070708_100025738
144 Ga0070685_10002774
145 Ga0070706_100030066
146 Ga0070706_100061082
147 Ga0070707_100000794
148 Ga0070707_100060562
149 Ga0070699_100006734
150 Ga0070699_100021755
151 Ga0070699_100059907
152 Ga0070697_100021188
153 Ga0068853_100062813
154 Ga0070695_100004385
155 Ga0070695_100010000
156 Ga0070696_100006656
157 Ga0070696_100033740
158 Ga0070704_100001118
159 Ga0070704_100001246
160 Ga0070704_100026546
161 Ga0068855_100004784
162 Ga0068857_100019473
163 Ga0068854_100003708
164 Ga0068870_10010795
165 Ga0068858_100000130
166 Ga0075428_100027468
167 Ga0075431_100004758
168 Ga0075433_10015419
169 Ga0075434_100027318
170 Ga0075429_100022551
171 Ga0075435_100001742
172 Ga0105244_10003323
173 Ga0111539_10000033
174 Ga0105245_10002776
175 Ga0114129_10045555
176 Ga0105242_10002186
177 Ga0105239_10082775
178 Ga0163162_10006425
179 Ga0157372_10003242
180 Ga0207653_10000126
181 Ga0207699_10006753
182 Ga0207643_10014919
183 Ga0207684_10003398
184 Ga0207684_10058651
185 Ga0207663_10000516
186 Ga0207663_10026420
187 Ga0207662_10027880
188 Ga0207646_10003071
189 Ga0207646_10041205
190 Ga0207650_10000035
191 Ga0207659_10000001
192 Ga0207687_10001169
193 Ga0207687_10015256
194 Ga0207700_10041322
195 Ga0207686_10006998
196 Ga0207670_10000798
197 Ga0207640_10001102
198 Ga0207677_10000230
199 Ga0207703_10036221
200 Ga0207639_10000013
201 Ga0207708_10009995
202 Ga0207641_10022986
203 Ga0207674_10030136
204 Ga0207675_100010123
205 Ga0209970_1000525
206 Ga0209588_1002683
207 Ga0209971_1000330
208 Ga0209998_10002047
209 Ga0209974_10000468
210 Ga0207428_10000001
211 Ga0268265_10036807
212 Ga0307511_10002839
213 Ga0307410_10006014
214 Ga0307410_10022624
215 Ga0307406_10016090
216 Ga0307412_10020647
217 Ga0307409_100019291
218 Ga0307416_100001617
219 Ga0307411_10001144
220 Ga0307415_100003435
221 Ga0373936_0000043
222 Ga0373961_0000372
223 Ga0373947_0015595
224 Ga0373925_0017350
225 Ga0395905_0067857
226 Ga0451577_0001689
227 Ga0453683_0006165
228 Ga0453683_0041590
229 Ga0453684_0000330
230 Ga0451576_0009214
231 Ga0451576_0013465
232 Ga0451576_0025166
233 Ga0451576_0027183
234 Ga0451576_0039729
235 Ga0495580_0004968
236 Ga0495580_0035570
237 Ga0495620_0000335
238 Ga0495684_0033900
239 Ga0496108_0000799
240 Ga0496109_0000316
241 Ga0496112_0000406
242 Ga0496113_0002332
243 Ga0501068_0012712
244 Ga0501073_0005712
245 Ga0501081_0044539
246 nmdc:mga09592_3555_c1
247 nmdc:mga06r32_16799_c1
248 nmdc:mga08y16_1_c1
249 nmdc:mga0n895_3546_c1
250 nmdc:mga0rr50_4329_c1
251 nmdc:mga08x19_40179_c1
252 nmdc:mga0a205_26759_c1
253 nmdc:mga0a205_357_c1
254 nmdc:mga0a205_5167_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

39

120

0.95

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

413

991

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.8133 132 994
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8126 31 113
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.809 132 994
2guf-assembly1.cif.gz_A in meso crystal structure of the cobalamin transporter, btub 0.8055 133 994
3irp-assembly1.cif.gz_X crystal structure of functional region of uafa from staphylococcus saprophyticus at 1.50 angstrom resolution 0.8052 26 113
ID Description Score Start End Superfamily
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9132 31 114 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8928 31 113 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8723 31 113 2.60.40.1120
af_I1NH52_350_429_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.869 28 113 2.60.40.1120
af_Q63041_348_434_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8619 36 75 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V9JJX5-F1-model_v4 TonB-dependent receptor 0.9633 24 98 GO:0030246
AF-A0A7J2SRQ5-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.941 26 115 GO:0004180
GO:0030246
AF-A0A1H5YCJ8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9345 27 117 GO:0004180
GO:0030246
AF-A0A2V8XE12-F1-model_v4 Uncharacterized protein 0.9146 28 115
AF-A0A496ALD1-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9079 26 115 GO:0030246

Map