F131260

General Info

Members Datasets Scaffolds Average Seq Length
126 70 252 198

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0952236|Ga0436364_0952236_15155_15859
Length 234
Sequence VRAHRLRLEATDRFRAEVALVPKLTRIYTRTGDDGTTGLVGGQRVKKSSLRIEAYGTIDELSSVLGLARTALAHVGGADGQVLDDATPPAIRVARELDAWLAWTQDALFNLGSDLATLPKDRWDGMPLIAASDAAALERAIDRAQRDLEPLANFIHPGGAYAGAFLHQARTVCRRAERLLIAARDQGEEISPDAVRYVNRLSDALFVWSRWINHALGTPEHLWNAKTAPPQLPR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
67 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.79
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0952236 3300037853 Bacteria 20152
2 LJNas_1001225 3300000546 Bacteria 3869
3 Ga0070658_10000043 3300005327 Bacteria 132337
4 Ga0070658_10002118 3300005327 Bacteria 16655
5 Ga0070691_10002660 3300005341 Bacteria 7955
6 Ga0070661_100123427 3300005344 Bacteria 1941
7 Ga0070709_10604498 3300005434 Bacteria 845
8 Ga0070709_10656204 3300005434 Bacteria 813
9 Ga0070714_100109053 3300005435 Bacteria 2449
10 Ga0070714_100575172 3300005435 Bacteria 1080
11 Ga0070713_100118982 3300005436 Bacteria 2314
12 Ga0070710_10327112 3300005437 Unclassified 1008
13 Ga0070711_100677105 3300005439 Unclassified 867
14 Ga0070663_100798821 3300005455 Bacteria 809
15 Ga0070663_101216773 3300005455 Unclassified 662
16 Ga0070681_10701127 3300005458 Bacteria 928
17 Ga0070698_100000806 3300005471 Bacteria 34225
18 Ga0070699_100001040 3300005518 Bacteria 25805
19 Ga0070679_100000551 3300005530 Bacteria 31803
20 Ga0070679_100410774 3300005530 Bacteria 1299
21 Ga0070679_100444112 3300005530 Bacteria 1242
22 Ga0070696_100016503 3300005546 Bacteria 4975
23 Ga0070704_100077813 3300005549 Bacteria 2431
24 Ga0068855_100000757 3300005563 Bacteria 39751
25 Ga0068855_100000855 3300005563 Bacteria 37784
26 Ga0068855_100051742 3300005563 Bacteria 4837
27 Ga0068854_100000023 3300005578 Bacteria 127086
28 Ga0068856_100127932 3300005614 Bacteria 2544
29 Ga0068852_100199208 3300005616 Bacteria 1894
30 Ga0070717_10111969 3300006028 Bacteria 2329
31 Ga0070717_10376140 3300006028 Bacteria 1273
32 Ga0099795_10076116 3300007788 Unclassified 1275
33 Ga0105240_10172902 3300009093 Bacteria 2557
34 Ga0105240_10435700 3300009093 Bacteria 1470
35 Ga0105243_10035214 3300009148 Bacteria 3880
36 Ga0105238_10179738 3300009551 Archaea 2093
37 Ga0099796_10090279 3300010159 Unclassified 1138
38 Ga0157370_10039382 3300013104 Bacteria 4567
39 Ga0157370_10757196 3300013104 Unclassified 885
40 Ga0157369_10048927 3300013105 Bacteria 4585
41 Ga0157369_10404431 3300013105 Bacteria 1416
42 Ga0157374_10334200 3300013296 Bacteria 1503
43 Ga0157372_10242422 3300013307 Bacteria 2092
44 Ga0157372_10389470 3300013307 Unclassified 1624
45 Ga0157380_10066721 3300014326 Bacteria 2895
46 Ga0157376_10009912 3300014969 Bacteria 6949
47 Ga0213872_10006245 3300021361 Bacteria 6018
48 Ga0213872_10013669 3300021361 Bacteria 3800
49 Ga0213872_10135065 3300021361 Bacteria 1085
50 Ga0213874_10057327 3300021377 Bacteria 1211
51 Ga0213876_10008449 3300021384 Bacteria 5573
52 Ga0213875_10000001 3300021388 Bacteria 2793540
53 Ga0213875_10001854 3300021388 Bacteria 13134
54 Ga0213875_10005810 3300021388 Bacteria 6566
55 Ga0213871_10010272 3300021441 Bacteria 2120
56 Ga0213871_10011919 3300021441 Bacteria 2006
57 Ga0213871_10093887 3300021441 Unclassified 872
58 Ga0207692_10071390 3300025898 Bacteria 1831
59 Ga0207705_10000034 3300025909 Bacteria 216943
60 Ga0207705_10071445 3300025909 Bacteria 2516
61 Ga0207663_10029948 3300025916 Bacteria 3204
62 Ga0207652_10122323 3300025921 Bacteria 2316
63 Ga0207652_10257506 3300025921 Bacteria 1574
64 Ga0207652_10794377 3300025921 Bacteria 841
65 Ga0207694_10172836 3300025924 Archaea 1750
66 Ga0207700_10146341 3300025928 Unclassified 1948
67 Ga0207664_10134217 3300025929 Bacteria 2087
68 Ga0207664_10206385 3300025929 Unclassified 1698
69 Ga0207664_10312469 3300025929 Unclassified 1385
70 Ga0207679_10827451 3300025945 Unclassified 845
71 Ga0207667_10000101 3300025949 Bacteria 137935
72 Ga0207667_10000251 3300025949 Bacteria 75691
73 Ga0207667_10007194 3300025949 Bacteria 13426
74 Ga0207667_10319993 3300025949 Bacteria 1584
75 Ga0207640_10000039 3300025981 Bacteria 107982
76 Ga0207678_10182168 3300026067 Bacteria 1794
77 Ga0207678_11125751 3300026067 Unclassified 695
78 Ga0207674_10047758 3300026116 Bacteria 4386
79 Ga0207698_10564498 3300026142 Bacteria 1117
80 Ga0265338_10104086 3300028800 Unclassified 2304
81 Ga0265325_10082487 3300031241 Bacteria 1596
82 Ga0265314_10002383 3300031711 Bacteria 19339
83 Ga0316576_10351803 3300031727 Bacteria 1096
84 Ga0373923_0250920 3300035111 Bacteria 828
85 Ga0373955_0198609 3300035172 Bacteria 1194
86 Ga0436364_0273345 3300037853 Bacteria 2794207
87 Ga0436364_0617320 3300037853 Bacteria 902
88 Ga0436364_0618629 3300037853 Unclassified 1627
89 Ga0436364_1357511 3300037853 Bacteria 3221
90 Ga0436364_1433963 3300037853 Bacteria 3201
91 Ga0400487_22360 3300039110 Bacteria 76631
92 Ga0436365_1168654 3300039437 Bacteria 11360
93 Ga0436360_0194393 3300039438 Bacteria 1248
94 Ga0436360_0260622 3300039438 Bacteria 7905
95 Ga0436360_0524446 3300039438 Bacteria 1004
96 Ga0436360_0578956 3300039438 Bacteria 876
97 Ga0436360_0641927 3300039438 Bacteria 5055
98 Ga0436360_0683616 3300039438 Bacteria 3265
99 Ga0436360_0755451 3300039438 Bacteria 4635
100 Ga0436360_0831542 3300039438 Bacteria 2351
101 Ga0436360_0899088 3300039438 Unclassified 832
102 Ga0436360_1121938 3300039438 Bacteria 4468
103 Ga0436360_1201784 3300039438 Bacteria 1421
104 Ga0436360_1209981 3300039438 Bacteria 1019
105 Ga0436361_0219623 3300039447 Bacteria 1848
106 Ga0436361_0257175 3300039447 Bacteria 1445
107 Ga0436361_0339651 3300039447 Bacteria 1464
108 Ga0436361_0507619 3300039447 Bacteria 5321
109 Ga0436361_0605718 3300039447 Bacteria 6295
110 Ga0436361_0993138 3300039447 Bacteria 10389
111 Ga0436363_1227565 3300039450 Unclassified 955
112 Ga0436362_0213552 3300039453 Bacteria 1176
113 Ga0436362_0304972 3300039453 Bacteria 1185
114 Ga0436362_0489940 3300039453 Bacteria 2991
115 Ga0436362_0796417 3300039453 Bacteria 1598
116 Ga0436362_1249588 3300039453 Bacteria 3781
117 Ga0436362_1254183 3300039453 Bacteria 945
118 Ga0495617_163730 3300046452 Unclassified 704
119 Ga0495645_0022665 3300046543 Unclassified 4544
120 Ga0495604_0077941 3300047317 Bacteria 2489
121 Ga0495672_0009576 3300047320 Bacteria 7001
122 Ga0495686_0150311 3300047472 Bacteria 1367
123 Ga0496110_0210572 3300048913 Bacteria 1767
124 Ga0496126_0000981 3300048929 Bacteria 48902
125 Ga0496126_0088803 3300048929 Bacteria 2722
126 Ga0496126_0778730 3300048929 Unclassified 736
127 Ga0436364_0952236
128 LJNas_1001225
129 Ga0070658_10000043
130 Ga0070658_10002118
131 Ga0070691_10002660
132 Ga0070661_100123427
133 Ga0070709_10604498
134 Ga0070709_10656204
135 Ga0070714_100109053
136 Ga0070714_100575172
137 Ga0070713_100118982
138 Ga0070710_10327112
139 Ga0070711_100677105
140 Ga0070663_100798821
141 Ga0070663_101216773
142 Ga0070681_10701127
143 Ga0070698_100000806
144 Ga0070699_100001040
145 Ga0070679_100000551
146 Ga0070679_100410774
147 Ga0070679_100444112
148 Ga0070696_100016503
149 Ga0070704_100077813
150 Ga0068855_100000757
151 Ga0068855_100000855
152 Ga0068855_100051742
153 Ga0068854_100000023
154 Ga0068856_100127932
155 Ga0068852_100199208
156 Ga0070717_10111969
157 Ga0070717_10376140
158 Ga0099795_10076116
159 Ga0105240_10172902
160 Ga0105240_10435700
161 Ga0105243_10035214
162 Ga0105238_10179738
163 Ga0099796_10090279
164 Ga0157370_10039382
165 Ga0157370_10757196
166 Ga0157369_10048927
167 Ga0157369_10404431
168 Ga0157374_10334200
169 Ga0157372_10242422
170 Ga0157372_10389470
171 Ga0157380_10066721
172 Ga0157376_10009912
173 Ga0213872_10006245
174 Ga0213872_10013669
175 Ga0213872_10135065
176 Ga0213874_10057327
177 Ga0213876_10008449
178 Ga0213875_10000001
179 Ga0213875_10001854
180 Ga0213875_10005810
181 Ga0213871_10010272
182 Ga0213871_10011919
183 Ga0213871_10093887
184 Ga0207692_10071390
185 Ga0207705_10000034
186 Ga0207705_10071445
187 Ga0207663_10029948
188 Ga0207652_10122323
189 Ga0207652_10257506
190 Ga0207652_10794377
191 Ga0207694_10172836
192 Ga0207700_10146341
193 Ga0207664_10134217
194 Ga0207664_10206385
195 Ga0207664_10312469
196 Ga0207679_10827451
197 Ga0207667_10000101
198 Ga0207667_10000251
199 Ga0207667_10007194
200 Ga0207667_10319993
201 Ga0207640_10000039
202 Ga0207678_10182168
203 Ga0207678_11125751
204 Ga0207674_10047758
205 Ga0207698_10564498
206 Ga0265338_10104086
207 Ga0265325_10082487
208 Ga0265314_10002383
209 Ga0316576_10351803
210 Ga0373923_0250920
211 Ga0373955_0198609
212 Ga0436364_0273345
213 Ga0436364_0617320
214 Ga0436364_0618629
215 Ga0436364_1357511
216 Ga0436364_1433963
217 Ga0400487_22360
218 Ga0436365_1168654
219 Ga0436360_0194393
220 Ga0436360_0260622
221 Ga0436360_0524446
222 Ga0436360_0578956
223 Ga0436360_0641927
224 Ga0436360_0683616
225 Ga0436360_0755451
226 Ga0436360_0831542
227 Ga0436360_0899088
228 Ga0436360_1121938
229 Ga0436360_1201784
230 Ga0436360_1209981
231 Ga0436361_0219623
232 Ga0436361_0257175
233 Ga0436361_0339651
234 Ga0436361_0507619
235 Ga0436361_0605718
236 Ga0436361_0993138
237 Ga0436363_1227565
238 Ga0436362_0213552
239 Ga0436362_0304972
240 Ga0436362_0489940
241 Ga0436362_0796417
242 Ga0436362_1249588
243 Ga0436362_1254183
244 Ga0495617_163730
245 Ga0495645_0022665
246 Ga0495604_0077941
247 Ga0495672_0009576
248 Ga0495686_0150311
249 Ga0496110_0210572
250 Ga0496126_0000981
251 Ga0496126_0088803
252 Ga0496126_0778730

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

27

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3k-assembly1.cif.gz_A cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp 0.9509 26 172
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9398 25 177
1wy1-assembly1.cif.gz_B crystal structure of the ph0671 protein from pyrococcus horikoshii ot3 0.9385 26 172
1wy1-assembly1.cif.gz_C crystal structure of the ph0671 protein from pyrococcus horikoshii ot3 0.9365 25 168
5cy5-assembly1.cif.gz_A crystal structure of the t33-51h designed self-assembling protein tetrahedron 0.9354 26 172
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9387 13 179 1.20.1200.10
5cy5A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9354 26 172 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9276 13 179 1.20.1200.10
4nwpB00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9124 23 171 1.20.1200.10
1wvtA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9061 26 179 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A7Y9T3M3-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9538 27 191 GO:0005524
GO:0008817
GO:0009236
AF-A0A2S8SPA0-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9532 1 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A4Q3XK04-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9504 1 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A2A4SSD4-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9488 1 171 GO:0005524
GO:0008817
GO:0009236
AF-A0A7W1GGN2-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9473 1 116 GO:0005524
GO:0008817
GO:0009236

Map