F131257

General Info

Members Datasets Scaffolds Average Seq Length
126 95 252 149

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0545952|Ga0436364_0545952_30975_31508
Length 164
Sequence VRRQALFCLARASTTLGTGSAYLWVKAAHLIFVIFWIAGLLMLPRYYVYHRAVASGAPEDALWIERERRLRKVIITPAMIIVWVLGLLLAANIGLFDGQAGLGWLHAKLAIVILLSGYHGWMIGYGKKLARGERPSSDRTLRIMNEVPTLATAIIVILVIVRPF

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
90 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
91 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
92 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
93 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
94 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
95 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 1.59
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 2.38
Rhizosphere 86.51
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0545952 3300037853 Bacteria 79385
2 JGI24741J21665_1010400 3300001915 Bacteria 1666
3 JGI24740J21852_10025439 3300001979 Bacteria 1995
4 JGI24739J22299_10002006 3300001989 Bacteria 7793
5 JGI24737J22298_10009573 3300001990 Bacteria 3215
6 JGI24735J21928_10018450 3300002067 Bacteria 2151
7 JGI24735J21928_10201295 3300002067 Bacteria 577
8 Ga0065707_10122038 3300005295 Bacteria 2097
9 Ga0065707_10190644 3300005295 Bacteria 1363
10 Ga0070689_101210005 3300005340 Bacteria 678
11 Ga0070661_100349910 3300005344 Bacteria 1159
12 Ga0070668_101616307 3300005347 Bacteria 594
13 Ga0070663_100010515 3300005455 Bacteria 5768
14 Ga0070662_100392381 3300005457 Bacteria 1144
15 Ga0070681_10488864 3300005458 Bacteria 1144
16 Ga0070679_100289620 3300005530 Bacteria 1589
17 Ga0068853_100100762 3300005539 Bacteria 2554
18 Ga0070665_101725630 3300005548 Bacteria 633
19 Ga0068855_100000468 3300005563 Bacteria 49550
20 Ga0068854_100359271 3300005578 Bacteria 1194
21 Ga0068854_100727405 3300005578 Bacteria 859
22 Ga0068856_100288948 3300005614 Bacteria 1656
23 Ga0068859_100239885 3300005617 Bacteria 1902
24 Ga0068859_102111303 3300005617 Bacteria 622
25 Ga0068858_100052637 3300005842 Bacteria 3766
26 Ga0068858_101010286 3300005842 Bacteria 815
27 Ga0081455_10550143 3300005937 Bacteria 763
28 Ga0068871_100069242 3300006358 Bacteria 2897
29 Ga0068871_100231359 3300006358 Bacteria 1604
30 Ga0097620_100239866 3300006931 Bacteria 1902
31 Ga0097620_102111016 3300006931 Bacteria 622
32 Ga0105240_10244320 3300009093 Bacteria 2079
33 Ga0105243_10809575 3300009148 Bacteria 924
34 Ga0105241_10389954 3300009174 Bacteria 1219
35 Ga0105248_10002631 3300009177 Bacteria 19969
36 Ga0105237_10074642 3300009545 Bacteria 3383
37 Ga0105237_10255077 3300009545 Bacteria 1756
38 Ga0105238_10054038 3300009551 Bacteria 4035
39 Ga0105249_10171938 3300009553 Bacteria 2102
40 Ga0105249_11711495 3300009553 Bacteria 701
41 Ga0105239_10447251 3300010375 Bacteria 1465
42 Ga0105239_11880104 3300010375 Bacteria 694
43 Ga0157373_10234550 3300013100 Bacteria 1296
44 Ga0157371_10085997 3300013102 Bacteria 2227
45 Ga0157374_10231701 3300013296 Bacteria 1814
46 Ga0163162_10569483 3300013306 Bacteria 1260
47 Ga0157380_10961352 3300014326 Bacteria 885
48 Ga0163161_10387572 3300017792 Bacteria 1118
49 Ga0163161_11503748 3300017792 Bacteria 591
50 Ga0213875_10000166 3300021388 Bacteria 68786
51 Ga0213875_10005824 3300021388 Bacteria 6555
52 Ga0207682_10261110 3300025893 Unclassified 808
53 Ga0207654_10147353 3300025911 Bacteria 1507
54 Ga0207707_10181255 3300025912 Bacteria 1839
55 Ga0207694_10063507 3300025924 Bacteria 2877
56 Ga0207679_10457014 3300025945 Bacteria 1133
57 Ga0207667_10007908 3300025949 Bacteria 12697
58 Ga0207651_11622245 3300025960 Bacteria 583
59 Ga0207640_10063468 3300025981 Bacteria 2455
60 Ga0207640_10708152 3300025981 Bacteria 864
61 Ga0207703_10039416 3300026035 Bacteria 3776
62 Ga0207708_10106503 3300026075 Bacteria 2174
63 Ga0207702_10230904 3300026078 Bacteria 1729
64 Ga0209998_10095897 3300027717 Bacteria 731
65 Ga0268266_11468448 3300028379 Bacteria 657
66 Ga0316182_1337079 3300030745 Bacteria 1149
67 Ga0265327_10036809 3300031251 Bacteria 2686
68 Ga0307509_10063328 3300031507 Bacteria 3894
69 Ga0307408_100265260 3300031548 Bacteria 1423
70 Ga0307405_10001457 3300031731 Bacteria 9965
71 Ga0307405_10155508 3300031731 Bacteria 1613
72 Ga0307405_10363984 3300031731 Bacteria 1120
73 Ga0307405_10431069 3300031731 Bacteria 1040
74 Ga0307405_10588848 3300031731 Bacteria 906
75 Ga0307405_11307236 3300031731 Bacteria 631
76 Ga0307413_10410315 3300031824 Bacteria 1064
77 Ga0307413_10818648 3300031824 Bacteria 784
78 Ga0307410_10798753 3300031852 Bacteria 802
79 Ga0307407_10104140 3300031903 Bacteria 1768
80 Ga0307407_10266227 3300031903 Bacteria 1181
81 Ga0307412_10004837 3300031911 Bacteria 7515
82 Ga0307412_10112347 3300031911 Bacteria 1947
83 Ga0307416_100060687 3300032002 Bacteria 3081
84 Ga0307416_101530509 3300032002 Bacteria 773
85 Ga0307414_10121763 3300032004 Bacteria 2007
86 Ga0307414_10481335 3300032004 Bacteria 1095
87 Ga0307411_10105424 3300032005 Bacteria 2004
88 Ga0307415_100128122 3300032126 Bacteria 1916
89 Ga0307510_10195137 3300033180 Bacteria 1567
90 Ga0436364_1432396 3300037853 Bacteria 23695
91 Ga0436365_1437700 3300039437 Bacteria 1183
92 Ga0436363_1482937 3300039450 Bacteria 566
93 Ga0466972_0097646 3300044658 Bacteria 1391
94 Ga0466965_0205004 3300044683 Bacteria 1047
95 Ga0466961_0048244 3300044693 Bacteria 2722
96 Ga0466961_0497131 3300044693 Bacteria 737
97 Ga0466963_0009959 3300044694 Bacteria 5742
98 Ga0466964_0066227 3300044706 Bacteria 1515
99 Ga0466968_0038381 3300044735 Bacteria 2012
100 Ga0466968_0038923 3300044735 Bacteria 1999
101 Ga0466970_0008131 3300044765 Bacteria 5267
102 Ga0466970_0042137 3300044765 Bacteria 2428
103 Ga0466957_0329246 3300044842 Bacteria 1032
104 Ga0466959_0130723 3300045049 Bacteria 1779
105 Ga0466958_0000948 3300045836 Bacteria 13102
106 Ga0466958_0069652 3300045836 Bacteria 2151
107 Ga0466967_0040980 3300045976 Bacteria 3989
108 Ga0466967_0127553 3300045976 Bacteria 2358
109 Ga0495607_0127720 3300046501 Bacteria 1327
110 Ga0495648_0013722 3300046524 Bacteria 5972
111 Ga0495663_0142674 3300046525 Bacteria 814
112 Ga0495598_0038519 3300046537 Bacteria 1385
113 Ga0495670_0084252 3300046691 Bacteria 1622
114 Ga0495671_0006295 3300046692 Bacteria 6871
115 Ga0496109_0360165 3300048912 Bacteria 1374
116 Ga0496109_0454429 3300048912 Bacteria 1210
117 Ga0496109_1359120 3300048912 Bacteria 646
118 Ga0501047_0134886 3300049581 Bacteria 2349
119 Ga0501044_0311714 3300049823 Bacteria 1500
120 Ga0500643_002054 3300053087 Bacteria 10775
121 Ga0500594_0001241 3300053118 Bacteria 5515
122 Ga0500573_0319969 3300053140 Bacteria 767
123 Ga0500622_0040793 3300053156 Bacteria 2417
124 2946790315 2946787523 Bacteria 4366789
125 2990268128 2990265787 Bacteria 3943888
126 2993696847 2993693658 Bacteria 4040749
127 Ga0436364_0545952
128 JGI24741J21665_1010400
129 JGI24740J21852_10025439
130 JGI24739J22299_10002006
131 JGI24737J22298_10009573
132 JGI24735J21928_10018450
133 JGI24735J21928_10201295
134 Ga0065707_10122038
135 Ga0065707_10190644
136 Ga0070689_101210005
137 Ga0070661_100349910
138 Ga0070668_101616307
139 Ga0070663_100010515
140 Ga0070662_100392381
141 Ga0070681_10488864
142 Ga0070679_100289620
143 Ga0068853_100100762
144 Ga0070665_101725630
145 Ga0068855_100000468
146 Ga0068854_100359271
147 Ga0068854_100727405
148 Ga0068856_100288948
149 Ga0068859_100239885
150 Ga0068859_102111303
151 Ga0068858_100052637
152 Ga0068858_101010286
153 Ga0081455_10550143
154 Ga0068871_100069242
155 Ga0068871_100231359
156 Ga0097620_100239866
157 Ga0097620_102111016
158 Ga0105240_10244320
159 Ga0105243_10809575
160 Ga0105241_10389954
161 Ga0105248_10002631
162 Ga0105237_10074642
163 Ga0105237_10255077
164 Ga0105238_10054038
165 Ga0105249_10171938
166 Ga0105249_11711495
167 Ga0105239_10447251
168 Ga0105239_11880104
169 Ga0157373_10234550
170 Ga0157371_10085997
171 Ga0157374_10231701
172 Ga0163162_10569483
173 Ga0157380_10961352
174 Ga0163161_10387572
175 Ga0163161_11503748
176 Ga0213875_10000166
177 Ga0213875_10005824
178 Ga0207682_10261110
179 Ga0207654_10147353
180 Ga0207707_10181255
181 Ga0207694_10063507
182 Ga0207679_10457014
183 Ga0207667_10007908
184 Ga0207651_11622245
185 Ga0207640_10063468
186 Ga0207640_10708152
187 Ga0207703_10039416
188 Ga0207708_10106503
189 Ga0207702_10230904
190 Ga0209998_10095897
191 Ga0268266_11468448
192 Ga0316182_1337079
193 Ga0265327_10036809
194 Ga0307509_10063328
195 Ga0307408_100265260
196 Ga0307405_10001457
197 Ga0307405_10155508
198 Ga0307405_10363984
199 Ga0307405_10431069
200 Ga0307405_10588848
201 Ga0307405_11307236
202 Ga0307413_10410315
203 Ga0307413_10818648
204 Ga0307410_10798753
205 Ga0307407_10104140
206 Ga0307407_10266227
207 Ga0307412_10004837
208 Ga0307412_10112347
209 Ga0307416_100060687
210 Ga0307416_101530509
211 Ga0307414_10121763
212 Ga0307414_10481335
213 Ga0307411_10105424
214 Ga0307415_100128122
215 Ga0307510_10195137
216 Ga0436364_1432396
217 Ga0436365_1437700
218 Ga0436363_1482937
219 Ga0466972_0097646
220 Ga0466965_0205004
221 Ga0466961_0048244
222 Ga0466961_0497131
223 Ga0466963_0009959
224 Ga0466964_0066227
225 Ga0466968_0038381
226 Ga0466968_0038923
227 Ga0466970_0008131
228 Ga0466970_0042137
229 Ga0466957_0329246
230 Ga0466959_0130723
231 Ga0466958_0000948
232 Ga0466958_0069652
233 Ga0466967_0040980
234 Ga0466967_0127553
235 Ga0495607_0127720
236 Ga0495648_0013722
237 Ga0495663_0142674
238 Ga0495598_0038519
239 Ga0495670_0084252
240 Ga0495671_0006295
241 Ga0496109_0360165
242 Ga0496109_0454429
243 Ga0496109_1359120
244 Ga0501047_0134886
245 Ga0501044_0311714
246 Ga0500643_002054
247 Ga0500594_0001241
248 Ga0500573_0319969
249 Ga0500622_0040793
250 2946790315
251 2990268128
252 2993696847

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

18

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h1j-assembly1.cif.gz_A cryo-em structure of the tnpb-omegarna-target dna ternary complex 0.7378 25 83
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6305 33 144
6hu9-assembly1.cif.gz_N iii2-iv2 mitochondrial respiratory supercomplex from s. cerevisiae 0.5639 11 146
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.5364 15 139
6giq-assembly1.cif.gz_N saccharomyces cerevisiae respiratory supercomplex iii2iv 0.5339 11 146
ID Description Score Start End Superfamily
af_Q7JYY8_1_96_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6325 10 104 1.20.5.110
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.6235 19 140 1.20.120.660
af_Q7JZW7_1_97_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6167 11 111 1.20.5.110
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.5963 19 140 1.20.120.660
af_Q7JYY8_1_96_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5924 10 104 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A3D1L6P9-F1-model_v4 deleted 0.9708 10 115
AF-A0A259IWI7-F1-model_v4 Protoporphyrinogen IX oxidase 0.9623 12 98 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A659YHV8-F1-model_v4 deleted 0.9594 9 108
AF-A0A1Y2J9X3-F1-model_v4 Protoporphyrinogen IX oxidase 0.9556 11 116 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A0F3IQX7-F1-model_v4 Protoporphyrinogen IX oxidase 0.9554 7 77 GO:0005886
GO:0006782
GO:0016491
GO:0046872

Map