F130989

General Info

Members Datasets Scaffolds Average Seq Length
126 99 252 141

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100585244|Ga0307408_1005852442
Length 138
Sequence MKKPDTNEAGSASDLISRKIAELDDWRGETLARMRKLIKEADPAVIEEWKWNTPVWSHDGIICTGESYKKAVKLTFAKGASLKDPKQLFNSSLEGNVRRAIDIPEGAGIDEAAFKALVREAVTLNSSGKPKAAKKARP

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
60 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
61 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
98 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
99 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.35
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100585244 3300031548 Bacteria 989
2 Ga0065715_10314641 3300005293 Bacteria 997
3 Ga0070670_102083481 3300005331 Bacteria 523
4 Ga0070682_100153417 3300005337 Bacteria 1583
5 Ga0070682_100169667 3300005337 Bacteria 1515
6 Ga0070669_101308629 3300005353 Bacteria 628
7 Ga0070659_100503889 3300005366 Bacteria 1032
8 Ga0070711_100968980 3300005439 Bacteria 729
9 Ga0070708_100773159 3300005445 Bacteria 903
10 Ga0070708_101012993 3300005445 Bacteria 779
11 Ga0070706_100010470 3300005467 Bacteria 8609
12 Ga0070698_101557352 3300005471 Bacteria 613
13 Ga0070699_100091918 3300005518 Bacteria 2654
14 Ga0070679_100188521 3300005530 Bacteria 2032
15 Ga0070684_100748449 3300005535 Bacteria 912
16 Ga0068853_100931690 3300005539 Bacteria 835
17 Ga0070686_100581577 3300005544 Bacteria 880
18 Ga0070704_101424613 3300005549 Bacteria 636
19 Ga0068857_100014156 3300005577 Bacteria 6947
20 Ga0068856_101074976 3300005614 Bacteria 822
21 Ga0068859_100042221 3300005617 Bacteria 4581
22 Ga0068859_100677103 3300005617 Bacteria 1123
23 Ga0068864_100042942 3300005618 Bacteria 3870
24 Ga0081455_10016059 3300005937 Bacteria 7243
25 Ga0081455_10099275 3300005937 Bacteria 2342
26 Ga0081538_10000145 3300005981 Bacteria 73612
27 Ga0075432_10210608 3300006058 Bacteria 773
28 Ga0070712_100527249 3300006175 Bacteria 993
29 Ga0097621_100009371 3300006237 Bacteria 7103
30 Ga0068871_100000626 3300006358 Bacteria 24276
31 Ga0075431_100043237 3300006847 Bacteria 4649
32 Ga0075433_10084364 3300006852 Bacteria 2804
33 Ga0075433_10875543 3300006852 Bacteria 784
34 Ga0075434_100498341 3300006871 Bacteria 1239
35 Ga0075434_100597485 3300006871 Bacteria 1123
36 Ga0075434_100845288 3300006871 Bacteria 931
37 Ga0075436_100027869 3300006914 Bacteria 3888
38 Ga0075436_100093980 3300006914 Bacteria 2085
39 Ga0097620_100042220 3300006931 Bacteria 4581
40 Ga0097620_100677037 3300006931 Bacteria 1123
41 Ga0075435_100247895 3300007076 Bacteria 1516
42 Ga0111539_10215591 3300009094 Bacteria 2236
43 Ga0114129_10006204 3300009147 Bacteria 16952
44 Ga0114129_10012435 3300009147 Bacteria 12116
45 Ga0105239_11167670 3300010375 Bacteria 887
46 Ga0105246_10733189 3300011119 Bacteria 870
47 Ga0157370_10002829 3300013104 Bacteria 20742
48 Ga0157378_10341940 3300013297 Bacteria 1459
49 Ga0157378_12090814 3300013297 Bacteria 617
50 Ga0157372_10772142 3300013307 Bacteria 1117
51 Ga0163163_10119676 3300014325 Bacteria 2666
52 Ga0207699_10560203 3300025906 Bacteria 830
53 Ga0207684_10085223 3300025910 Bacteria 2692
54 Ga0207684_10506622 3300025910 Bacteria 1034
55 Ga0207652_10148718 3300025921 Bacteria 2097
56 Ga0207687_10234453 3300025927 Bacteria 1451
57 Ga0207690_11154288 3300025932 Bacteria 646
58 Ga0207691_10707664 3300025940 Bacteria 849
59 Ga0207639_10776403 3300026041 Bacteria 892
60 Ga0207676_10032985 3300026095 Bacteria 3909
61 Ga0207674_10026437 3300026116 Bacteria 6163
62 Ga0268264_11386661 3300028381 Bacteria 713
63 Ga0265325_10165178 3300031241 Bacteria 1039
64 Ga0307408_100369528 3300031548 Bacteria 1223
65 Ga0307413_10410417 3300031824 Bacteria 1064
66 Ga0307410_10146839 3300031852 Bacteria 1751
67 Ga0307410_10474264 3300031852 Bacteria 1025
68 Ga0307407_10043852 3300031903 Bacteria 2517
69 Ga0307407_10790427 3300031903 Bacteria 721
70 Ga0307409_100035703 3300031995 Bacteria 3645
71 Ga0307409_100082318 3300031995 Bacteria 2605
72 Ga0307416_100009933 3300032002 Bacteria 6261
73 Ga0307414_10564538 3300032004 Bacteria 1016
74 Ga0307411_10053013 3300032005 Bacteria 2655
75 Ga0373940_0079343 3300035088 Bacteria 968
76 Ga0373939_0091158 3300035114 Bacteria 1030
77 Ga0373941_0028942 3300035115 Bacteria 1630
78 Ga0373941_0161728 3300035115 Bacteria 828
79 Ga0373927_0393588 3300035695 Bacteria 914
80 Ga0373947_0528609 3300035725 Bacteria 802
81 Ga0373937_1229624 3300036401 Bacteria 697
82 Ga0373925_0196119 3300037068 Bacteria 1604
83 Ga0373925_1535498 3300037068 Bacteria 545
84 Ga0395900_0087816 3300037418 Bacteria 3196
85 Ga0395905_0014052 3300037471 Bacteria 7656
86 Ga0395905_0036353 3300037471 Bacteria 4625
87 Ga0395905_0043293 3300037471 Bacteria 4224
88 Ga0395901_0349552 3300038443 Bacteria 1526
89 Ga0436363_0581114 3300039450 Bacteria 976
90 Ga0451577_0123785 3300042876 Bacteria 2317
91 Ga0495580_0004177 3300046472 Bacteria 12148
92 Ga0495580_0046543 3300046472 Bacteria 3077
93 Ga0495580_0257065 3300046472 Unclassified 1195
94 Ga0495639_0182246 3300046475 Bacteria 1023
95 Ga0495594_0066081 3300046499 Bacteria 2006
96 Ga0495630_0856064 3300046517 Bacteria 693
97 Ga0495658_0438724 3300046683 Bacteria 834
98 Ga0496101_0581316 3300048904 Bacteria 886
99 Ga0496104_0366041 3300048907 Unclassified 1354
100 Ga0496105_1217006 3300048908 Bacteria 554
101 Ga0496108_1008500 3300048911 Bacteria 711
102 Ga0496109_0365607 3300048912 Unclassified 1363
103 Ga0496112_0150964 3300048915 Bacteria 2291
104 Ga0496112_0430549 3300048915 Bacteria 1258
105 Ga0496113_0634557 3300048916 Bacteria 855
106 Ga0501071_0681798 3300049587 Bacteria 791
107 Ga0501074_0736922 3300049590 Bacteria 695
108 Ga0501075_1319555 3300049591 Bacteria 547
109 Ga0501076_0936679 3300049592 Bacteria 714
110 Ga0501077_0199583 3300049593 Bacteria 1271
111 Ga0501045_1433759 3300049824 Bacteria 501
112 nmdc:mga05p37_18717_c1 3300050507 Bacteria 8368
113 nmdc:mga05p37_42616_c1 3300050507 Bacteria 5578
114 nmdc:mga06r32_200043_c1 3300050510 Bacteria 1986
115 nmdc:mga08y16_128488_c1 3300050511 Bacteria 2636
116 nmdc:mga08y16_133652_c1 3300050511 Bacteria 2578
117 nmdc:mga0n895_122946_c1 3300050512 Bacteria 2617
118 nmdc:mga0n895_498408_c1 3300050512 Bacteria 1227
119 nmdc:mga0n895_81635_c1 3300050512 Bacteria 3222
120 nmdc:mga0rr50_216238_c1 3300050513 Bacteria 1581
121 nmdc:mga0a205_97169_c1 3300050515 Bacteria 2844
122 Ga0495619_0018535 3300053085 Bacteria 4416
123 Ga0501084_0950138 3300054114 Bacteria 723
124 Ga0590074_038283 3300059423 Bacteria 859
125 Ga0590075_041578 3300059424 Bacteria 1175
126 Ga0501082_0747459 3300060353 Bacteria 856
127 Ga0307408_100585244
128 Ga0065715_10314641
129 Ga0070670_102083481
130 Ga0070682_100153417
131 Ga0070682_100169667
132 Ga0070669_101308629
133 Ga0070659_100503889
134 Ga0070711_100968980
135 Ga0070708_100773159
136 Ga0070708_101012993
137 Ga0070706_100010470
138 Ga0070698_101557352
139 Ga0070699_100091918
140 Ga0070679_100188521
141 Ga0070684_100748449
142 Ga0068853_100931690
143 Ga0070686_100581577
144 Ga0070704_101424613
145 Ga0068857_100014156
146 Ga0068856_101074976
147 Ga0068859_100042221
148 Ga0068859_100677103
149 Ga0068864_100042942
150 Ga0081455_10016059
151 Ga0081455_10099275
152 Ga0081538_10000145
153 Ga0075432_10210608
154 Ga0070712_100527249
155 Ga0097621_100009371
156 Ga0068871_100000626
157 Ga0075431_100043237
158 Ga0075433_10084364
159 Ga0075433_10875543
160 Ga0075434_100498341
161 Ga0075434_100597485
162 Ga0075434_100845288
163 Ga0075436_100027869
164 Ga0075436_100093980
165 Ga0097620_100042220
166 Ga0097620_100677037
167 Ga0075435_100247895
168 Ga0111539_10215591
169 Ga0114129_10006204
170 Ga0114129_10012435
171 Ga0105239_11167670
172 Ga0105246_10733189
173 Ga0157370_10002829
174 Ga0157378_10341940
175 Ga0157378_12090814
176 Ga0157372_10772142
177 Ga0163163_10119676
178 Ga0207699_10560203
179 Ga0207684_10085223
180 Ga0207684_10506622
181 Ga0207652_10148718
182 Ga0207687_10234453
183 Ga0207690_11154288
184 Ga0207691_10707664
185 Ga0207639_10776403
186 Ga0207676_10032985
187 Ga0207674_10026437
188 Ga0268264_11386661
189 Ga0265325_10165178
190 Ga0307408_100369528
191 Ga0307413_10410417
192 Ga0307410_10146839
193 Ga0307410_10474264
194 Ga0307407_10043852
195 Ga0307407_10790427
196 Ga0307409_100035703
197 Ga0307409_100082318
198 Ga0307416_100009933
199 Ga0307414_10564538
200 Ga0307411_10053013
201 Ga0373940_0079343
202 Ga0373939_0091158
203 Ga0373941_0028942
204 Ga0373941_0161728
205 Ga0373927_0393588
206 Ga0373947_0528609
207 Ga0373937_1229624
208 Ga0373925_0196119
209 Ga0373925_1535498
210 Ga0395900_0087816
211 Ga0395905_0014052
212 Ga0395905_0036353
213 Ga0395905_0043293
214 Ga0395901_0349552
215 Ga0436363_0581114
216 Ga0451577_0123785
217 Ga0495580_0004177
218 Ga0495580_0046543
219 Ga0495580_0257065
220 Ga0495639_0182246
221 Ga0495594_0066081
222 Ga0495630_0856064
223 Ga0495658_0438724
224 Ga0496101_0581316
225 Ga0496104_0366041
226 Ga0496105_1217006
227 Ga0496108_1008500
228 Ga0496109_0365607
229 Ga0496112_0150964
230 Ga0496112_0430549
231 Ga0496113_0634557
232 Ga0501071_0681798
233 Ga0501074_0736922
234 Ga0501075_1319555
235 Ga0501076_0936679
236 Ga0501077_0199583
237 Ga0501045_1433759
238 nmdc:mga05p37_18717_c1
239 nmdc:mga05p37_42616_c1
240 nmdc:mga06r32_200043_c1
241 nmdc:mga08y16_128488_c1
242 nmdc:mga08y16_133652_c1
243 nmdc:mga0n895_122946_c1
244 nmdc:mga0n895_498408_c1
245 nmdc:mga0n895_81635_c1
246 nmdc:mga0rr50_216238_c1
247 nmdc:mga0a205_97169_c1
248 Ga0495619_0018535
249 Ga0501084_0950138
250 Ga0590074_038283
251 Ga0590075_041578
252 Ga0501082_0747459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

27

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6csj-assembly4.cif.gz_D structure of a bacillus coagulans polyol dehydrogenase double mutant with an acquired d-lactate dehydrogenase activity 0.8113 111 137
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7386 16 132
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7263 10 129
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7055 10 129
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.671 16 132
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8077 16 128 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7766 16 128 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6801 16 135 3.90.1150.200
af_B8A580_83_200_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.6709 68 113 2.60.40.3210
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6548 16 135 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A370D3G0-F1-model_v4 deleted 0.9933 12 132
AF-A0A1E4DJ85-F1-model_v4 deleted 0.9917 10 139
AF-A0A1Q3J442-F1-model_v4 deleted 0.9917 11 139
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.9903 6 138
AF-A0A1X2DM13-F1-model_v4 YdhG-like domain-containing protein 0.9887 10 139

Map