F130384

General Info

Members Datasets Scaffolds Average Seq Length
126 121 252 206

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10001149|Ga0157373_1000114916
Length 236
Sequence LKDAPILPGRRGGYVNLIKKRQENGMTKILILGASGQIARQVVDILAERNSAELTLFLRDAKKLGRKIPANTRVIEGDVHDAAKLKEAMGGQDVVYANLAGDVDTQAAAIIAAMNVTGVRKLIFCTTLGIYDEVPGEFGEWNNREIGEYFPPYRKAADLIEASGLDYAVLRPAWLTDADEVDYETTERNEPFKGTEVARKSVAALVVELVAVPGALGNRNIGVNKPDTDGDKPAFM

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
30 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
85 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
102 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
103 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
104 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
105 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
106 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
107 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
108 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
109 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
110 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
111 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
112 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
113 2636415599 Klebsiella variicola DX120E Isolate Unclassified
114 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
115 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
116 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
117 2849139964 Bacillus sp. R-71875 Isolate Unclassified
118 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
119 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
120 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
121 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.92
Metatranscriptomes 0
Isolates 15.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0.79
Rhizoplane 4.76
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10001149 3300013100 Bacteria 20277
2 JGI25154J39366_1000414 3300002738 Bacteria 22970
3 JGI25151J46595_10004760 3300003187 Bacteria 7119
4 JGI25165J46597_1000055 3300003214 Bacteria 224187
5 rootH1_10221295 3300003323 Bacteria 3193
6 Ga0055533_1001183 3300003756 Bacteria 7356
7 Ga0070683_100448961 3300005329 Bacteria 1230
8 Ga0070713_100039994 3300005436 Bacteria 3810
9 Ga0070708_100058984 3300005445 Bacteria 3420
10 Ga0070707_100029863 3300005468 Bacteria 5187
11 Ga0070698_100117923 3300005471 Bacteria 2616
12 Ga0070699_100705216 3300005518 Bacteria 922
13 Ga0068854_100830776 3300005578 Bacteria 807
14 Ga0081538_10002723 3300005981 Bacteria 16985
15 Ga0070717_10932581 3300006028 Bacteria 791
16 Ga0070712_100021017 3300006175 Bacteria 4280
17 Ga0105244_10000376 3300009036 Bacteria 41530
18 Ga0105243_11088793 3300009148 Unclassified 807
19 Ga0105242_10251428 3300009176 Bacteria 1593
20 Ga0157369_10204924 3300013105 Bacteria 2069
21 Ga0157378_10003857 3300013297 Bacteria 13263
22 Ga0183368_1002 3300015687 Bacteria 1865598
23 Ga0213872_10003637 3300021361 Bacteria 8456
24 Ga0213876_10035709 3300021384 Bacteria 2622
25 Ga0213875_10129744 3300021388 Bacteria 1179
26 Ga0209674_100016 3300025226 Bacteria 696756
27 Ga0207427_100054 3300025231 Bacteria 216315
28 Ga0209437_100339 3300025233 Bacteria 56482
29 Ga0209646_1000268 3300025246 Bacteria 49238
30 Ga0209759_1000993 3300025256 Bacteria 19459
31 Ga0209233_1000001 3300025261 Bacteria 2992747
32 Ga0209025_1001741 3300025294 Bacteria 26141
33 Ga0207655_1000237 3300025728 Bacteria 91108
34 Ga0207693_10068445 3300025915 Bacteria 2779
35 Ga0207664_10001981 3300025929 Bacteria 13482
36 Ga0207661_10819259 3300025944 Unclassified 857
37 Ga0265323_10005044 3300028653 Bacteria 5638
38 Ga0307515_10073682 3300028794 Bacteria 4584
39 Ga0265332_10037161 3300031238 Bacteria 2113
40 Ga0265327_10011003 3300031251 Bacteria 6293
41 Ga0265327_10015381 3300031251 Bacteria 4942
42 Ga0265316_10410511 3300031344 Bacteria 974
43 Ga0265316_10722087 3300031344 Bacteria 701
44 Ga0307513_10000003 3300031456 Bacteria 590921
45 Ga0307408_100078900 3300031548 Bacteria 2455
46 Ga0307408_100154779 3300031548 Bacteria 1814
47 Ga0265342_10058658 3300031712 Bacteria 2275
48 Ga0316578_10048711 3300031728 Bacteria 2475
49 Ga0307516_10134202 3300031730 Bacteria 2252
50 Ga0307405_10065079 3300031731 Bacteria 2319
51 Ga0307410_10027463 3300031852 Bacteria 3598
52 Ga0307412_10281815 3300031911 Bacteria 1305
53 Ga0307409_100233482 3300031995 Bacteria 1669
54 Ga0307416_100017276 3300032002 Bacteria 5041
55 Ga0373953_0096796 3300035117 Bacteria 1239
56 Ga0373933_0187613 3300035724 Bacteria 1320
57 Ga0373937_0124365 3300036401 Bacteria 2405
58 Ga0395899_0002067 3300037312 Bacteria 16523
59 Ga0395900_0185630 3300037418 Bacteria 2111
60 Ga0436365_1860535 3300039437 Bacteria 7494
61 Ga0436361_0389628 3300039447 Bacteria 39329
62 Ga0451577_0009930 3300042876 Bacteria 9125
63 Ga0451577_0026228 3300042876 Bacteria 5278
64 Ga0453684_1001814 3300044712 Unclassified 888
65 Ga0495651_0017499 3300046462 Bacteria 5552
66 Ga0495653_0024015 3300046463 Bacteria 4918
67 Ga0495664_0078833 3300046477 Bacteria 1973
68 Ga0495584_0038469 3300046491 Bacteria 2418
69 Ga0495596_0056144 3300046500 Bacteria 1538
70 Ga0495606_0273815 3300046507 Bacteria 926
71 Ga0495610_0104633 3300046512 Bacteria 1262
72 Ga0495618_0056074 3300046514 Bacteria 2495
73 Ga0495628_0176920 3300046516 Unclassified 1615
74 Ga0495652_0027301 3300046529 Bacteria 5031
75 Ga0495587_0088042 3300046536 Bacteria 1797
76 Ga0495609_0170340 3300046538 Bacteria 920
77 Ga0495597_0010470 3300046542 Bacteria 4531
78 Ga0495645_0048774 3300046543 Bacteria 3084
79 Ga0495611_0000095 3300046648 Bacteria 61293
80 Ga0495661_0095071 3300046665 Bacteria 1688
81 Ga0495588_0014565 3300046674 Bacteria 3765
82 Ga0495669_0101720 3300046684 Bacteria 1335
83 Ga0495600_0140818 3300046809 Bacteria 1565
84 Ga0495636_0016299 3300047318 Bacteria 2967
85 Ga0495680_0080717 3300047322 Bacteria 2457
86 Ga0495679_079201 3300047446 Bacteria 935
87 Ga0495602_0046431 3300048088 Bacteria 3923
88 Ga0495602_0259701 3300048088 Bacteria 1289
89 Ga0495615_0092191 3300048090 Bacteria 846
90 Ga0495626_0135104 3300048091 Bacteria 1050
91 Ga0496112_0401774 3300048915 Bacteria 1310
92 Ga0496126_0006207 3300048929 Bacteria 13369
93 Ga0501031_0175976 3300049568 Bacteria 1398
94 Ga0501033_0016096 3300049570 Bacteria 5663
95 Ga0501034_0097984 3300049571 Bacteria 2928
96 Ga0501036_0468630 3300049572 Bacteria 1049
97 Ga0501038_0450021 3300049574 Bacteria 990
98 Ga0501043_0117882 3300049579 Bacteria 2083
99 Ga0501047_0039702 3300049581 Bacteria 4552
100 Ga0501070_0004873 3300049586 Bacteria 11467
101 Ga0501074_0388177 3300049590 Bacteria 990
102 Ga0501249_045834 3300049679 Bacteria 998
103 Ga0501080_0140911 3300049742 Bacteria 2229
104 Ga0501035_0002832 3300049822 Bacteria 16768
105 Ga0501044_0020943 3300049823 Bacteria 6982
106 Ga0495595_0104290 3300053084 Bacteria 1370
107 Ga0500618_000041 3300053125 Bacteria 111404
108 2554249209 2554235003 Bacteria 5877155
109 2585220728 2582581298 Bacteria 7315509
110 2585548530 2585427529 Bacteria 7395659
111 2587742223 2585428059 Bacteria 8696589
112 2588217040 2585428183 Bacteria 5166119
113 2588217412 2585428184 Bacteria 4978681
114 2599409379 2599185169 Bacteria 5441380
115 2601739945 2600255307 Bacteria 5439064
116 2601750434 2600255309 Bacteria 5431045
117 2602017687 2600255392 Bacteria 5437392
118 2637225275 2636415599 Bacteria 5718434
119 2676406524 2675903046 Bacteria 5451247
120 2784473565 2784132109 Bacteria 3141763
121 2792835624 2791355137 Bacteria 9654227
122 2849145469 2849139964 Bacteria 5613304
123 2885529522 2885526491 Bacteria 7164189
124 2900638030 2900634093 Bacteria 10263517
125 2904164800 2904162308 Bacteria 7086713
126 2921256095 2921250672 Bacteria 6677771
127 Ga0157373_10001149
128 JGI25154J39366_1000414
129 JGI25151J46595_10004760
130 JGI25165J46597_1000055
131 rootH1_10221295
132 Ga0055533_1001183
133 Ga0070683_100448961
134 Ga0070713_100039994
135 Ga0070708_100058984
136 Ga0070707_100029863
137 Ga0070698_100117923
138 Ga0070699_100705216
139 Ga0068854_100830776
140 Ga0081538_10002723
141 Ga0070717_10932581
142 Ga0070712_100021017
143 Ga0105244_10000376
144 Ga0105243_11088793
145 Ga0105242_10251428
146 Ga0157369_10204924
147 Ga0157378_10003857
148 Ga0183368_1002
149 Ga0213872_10003637
150 Ga0213876_10035709
151 Ga0213875_10129744
152 Ga0209674_100016
153 Ga0207427_100054
154 Ga0209437_100339
155 Ga0209646_1000268
156 Ga0209759_1000993
157 Ga0209233_1000001
158 Ga0209025_1001741
159 Ga0207655_1000237
160 Ga0207693_10068445
161 Ga0207664_10001981
162 Ga0207661_10819259
163 Ga0265323_10005044
164 Ga0307515_10073682
165 Ga0265332_10037161
166 Ga0265327_10011003
167 Ga0265327_10015381
168 Ga0265316_10410511
169 Ga0265316_10722087
170 Ga0307513_10000003
171 Ga0307408_100078900
172 Ga0307408_100154779
173 Ga0265342_10058658
174 Ga0316578_10048711
175 Ga0307516_10134202
176 Ga0307405_10065079
177 Ga0307410_10027463
178 Ga0307412_10281815
179 Ga0307409_100233482
180 Ga0307416_100017276
181 Ga0373953_0096796
182 Ga0373933_0187613
183 Ga0373937_0124365
184 Ga0395899_0002067
185 Ga0395900_0185630
186 Ga0436365_1860535
187 Ga0436361_0389628
188 Ga0451577_0009930
189 Ga0451577_0026228
190 Ga0453684_1001814
191 Ga0495651_0017499
192 Ga0495653_0024015
193 Ga0495664_0078833
194 Ga0495584_0038469
195 Ga0495596_0056144
196 Ga0495606_0273815
197 Ga0495610_0104633
198 Ga0495618_0056074
199 Ga0495628_0176920
200 Ga0495652_0027301
201 Ga0495587_0088042
202 Ga0495609_0170340
203 Ga0495597_0010470
204 Ga0495645_0048774
205 Ga0495611_0000095
206 Ga0495661_0095071
207 Ga0495588_0014565
208 Ga0495669_0101720
209 Ga0495600_0140818
210 Ga0495636_0016299
211 Ga0495680_0080717
212 Ga0495679_079201
213 Ga0495602_0046431
214 Ga0495602_0259701
215 Ga0495615_0092191
216 Ga0495626_0135104
217 Ga0496112_0401774
218 Ga0496126_0006207
219 Ga0501031_0175976
220 Ga0501033_0016096
221 Ga0501034_0097984
222 Ga0501036_0468630
223 Ga0501038_0450021
224 Ga0501043_0117882
225 Ga0501047_0039702
226 Ga0501070_0004873
227 Ga0501074_0388177
228 Ga0501249_045834
229 Ga0501080_0140911
230 Ga0501035_0002832
231 Ga0501044_0020943
232 Ga0495595_0104290
233 Ga0500618_000041
234 2554249209
235 2585220728
236 2585548530
237 2587742223
238 2588217040
239 2588217412
240 2599409379
241 2601739945
242 2601750434
243 2602017687
244 2637225275
245 2676406524
246 2784473565
247 2792835624
248 2849145469
249 2885529522
250 2900638030
251 2904164800
252 2921256095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

33

213

0.97

PF05368

NmrA

NmrA-like family

29

143

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

30

132

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

29

172

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qvo-assembly1.cif.gz_A structure of a rossmann-fold nad(p)-binding family protein from shigella flexneri. 0.9583 1 210
3qvo-assembly1.cif.gz_A structure of a rossmann-fold nad(p)-binding family protein from shigella flexneri. 0.9346 1 210
4hnh-assembly2.cif.gz_B the crystal structure of a short-chain dehydrogenases/reductase (wide type) from veillonella parvula dsm 2008 in complex with nadp 0.9251 2 211
4ipt-assembly1.cif.gz_A the crystal structure of a short-chain dehydrogenases/reductase (ethylated) from veillonella parvula dsm 2008 0.9216 2 213
4ipt-assembly1.cif.gz_A the crystal structure of a short-chain dehydrogenases/reductase (ethylated) from veillonella parvula dsm 2008 0.9133 2 213
ID Description Score Start End Superfamily
3qvoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 1 210 3.40.50.720
3qvoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 1 210 3.40.50.720
af_Q2EER5_1_57_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9169 1 52 3.40.50.720
3r14A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9149 1 213 3.40.50.720
3r14A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9108 1 213 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0E2BP58-F1-model_v4 deleted 0.9963 88 213
AF-A0A822TQW8-F1-model_v4 deleted 0.9891 91 213
AF-A0A0M2WLS8-F1-model_v4 NAD(P)-binding domain-containing protein 0.989 65 212
AF-A0A4V6Z463-F1-model_v4 deleted 0.9862 83 210
AF-A0A0R1MKI4-F1-model_v4 NAD-dependent epimerase dehydratase 0.985 1 213 GO:0004074
GO:0042602

Map