F128978

General Info

Members Datasets Scaffolds Average Seq Length
126 102 126 179

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10094750|Ga0065707_100947505
Length 184
Sequence MTAIVPEAIEFSAALTRAQAGDHDAFAELVERHEAMVYSLAWHFFNDRSRAEEVAQDVFLQLYRNLASLETEAHVLFWLRQVTTRRCIDQVRRTRMKAVSLDDAGELRAVDQRADPFLDRRLKNLIQELPELQRAVVTLRYQEDLDPSEICRIVGLPVNTVKSHLHRALQSLRKKLDRKPEKQS

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10094750 3300005295 Bacteria 3457
2 Ga0070658_10295458 3300005327 Bacteria 1381
3 Ga0070683_100265076 3300005329 Bacteria 1634
4 Ga0070677_10162927 3300005333 Bacteria 1048
5 Ga0070680_100027865 3300005336 Bacteria 4527
6 Ga0070682_100000035 3300005337 Bacteria 150016
7 Ga0070689_100010149 3300005340 Bacteria 6707
8 Ga0070689_100257324 3300005340 Unclassified 1442
9 Ga0070675_100000002 3300005354 Bacteria 435215
10 Ga0070671_100122925 3300005355 Bacteria 2185
11 Ga0070709_10447842 3300005434 Bacteria 972
12 Ga0070713_100047690 3300005436 Bacteria 3523
13 Ga0070710_10119880 3300005437 Bacteria 1591
14 Ga0070700_100000078 3300005441 Bacteria 65986
15 Ga0070708_101003720 3300005445 Bacteria 783
16 Ga0070685_10147903 3300005466 Bacteria 1486
17 Ga0070706_100003880 3300005467 Bacteria 14600
18 Ga0070706_100495651 3300005467 Bacteria 1137
19 Ga0070707_100018583 3300005468 Bacteria 6540
20 Ga0070707_100065183 3300005468 Bacteria 3499
21 Ga0070698_100141721 3300005471 Bacteria 2355
22 Ga0070699_100010866 3300005518 Bacteria 7877
23 Ga0070684_100267866 3300005535 Bacteria 1563
24 Ga0068853_101187755 3300005539 Unclassified 736
25 Ga0070672_100000360 3300005543 Bacteria 26221
26 Ga0068857_100053805 3300005577 Bacteria 3571
27 Ga0070702_100082118 3300005615 Bacteria 1933
28 Ga0070702_100307002 3300005615 Bacteria 1100
29 Ga0068852_101163260 3300005616 Bacteria 792
30 Ga0068864_100000007 3300005618 Bacteria 392187
31 Ga0068861_100091957 3300005719 Unclassified 2396
32 Ga0068861_100804635 3300005719 Unclassified 882
33 Ga0068870_10419469 3300005840 Bacteria 875
34 Ga0068858_100000717 3300005842 Bacteria 34513
35 Ga0068858_100547805 3300005842 Unclassified 1120
36 Ga0070717_10000062 3300006028 Bacteria 91165
37 Ga0070717_10875035 3300006028 Bacteria 818
38 Ga0070716_100169362 3300006173 Unclassified 1424
39 Ga0070716_100744029 3300006173 Unclassified 754
40 Ga0075428_100001909 3300006844 Bacteria 22365
41 Ga0075431_100004486 3300006847 Bacteria 13696
42 Ga0075434_100454638 3300006871 Bacteria 1302
43 Ga0075434_100664104 3300006871 Unclassified 1060
44 Ga0075429_100544950 3300006880 Bacteria 1017
45 Ga0068865_100026361 3300006881 Bacteria 3832
46 Ga0075435_100000070 3300007076 Bacteria 52706
47 Ga0075435_100111448 3300007076 Bacteria 2276
48 Ga0105240_10762414 3300009093 Unclassified 1051
49 Ga0111539_10000837 3300009094 Bacteria 40029
50 Ga0111539_10102302 3300009094 Unclassified 3362
51 Ga0105245_10090120 3300009098 Bacteria 2820
52 Ga0105242_10005722 3300009176 Bacteria 9584
53 Ga0105249_10502397 3300009553 Bacteria 1258
54 Ga0157369_10838110 3300013105 Unclassified 944
55 Ga0157378_10002183 3300013297 Bacteria 17353
56 Ga0157378_10157143 3300013297 Bacteria 2124
57 Ga0163162_11169543 3300013306 Unclassified 872
58 Ga0157375_10000003 3300013308 Bacteria 476325
59 Ga0157380_10001100 3300014326 Bacteria 17432
60 Ga0157377_10000126 3300014745 Bacteria 49710
61 Ga0157379_10525658 3300014968 Unclassified 1099
62 Ga0213873_10000002 3300021358 Bacteria 1164195
63 Ga0213876_10000001 3300021384 Bacteria 1186326
64 Ga0213876_10004055 3300021384 Bacteria 8246
65 Ga0207692_10271189 3300025898 Bacteria 1023
66 Ga0207643_10360405 3300025908 Bacteria 914
67 Ga0207684_10080309 3300025910 Bacteria 2774
68 Ga0207695_10208050 3300025913 Unclassified 1868
69 Ga0207660_10042623 3300025917 Unclassified 3187
70 Ga0207662_10295434 3300025918 Unclassified 1075
71 Ga0207646_10019065 3300025922 Bacteria 6384
72 Ga0207646_10039710 3300025922 Bacteria 4235
73 Ga0207659_10000005 3300025926 Bacteria 405839
74 Ga0207687_10020422 3300025927 Bacteria 4393
75 Ga0207700_10102345 3300025928 Bacteria 2287
76 Ga0207686_10009919 3300025934 Bacteria 5176
77 Ga0207670_10000628 3300025936 Bacteria 18941
78 Ga0207704_10022802 3300025938 Bacteria 3362
79 Ga0207665_10198830 3300025939 Bacteria 1460
80 Ga0207691_10002666 3300025940 Bacteria 17436
81 Ga0207689_10143784 3300025942 Bacteria 1965
82 Ga0207661_10268764 3300025944 Bacteria 1521
83 Ga0207703_10003486 3300026035 Bacteria 13169
84 Ga0207703_10654401 3300026035 Bacteria 997
85 Ga0207639_10000003 3300026041 Bacteria 806887
86 Ga0207708_10000018 3300026075 Bacteria 188140
87 Ga0207648_10999573 3300026089 Bacteria 783
88 Ga0207676_10000015 3300026095 Bacteria 329100
89 Ga0207674_10023073 3300026116 Bacteria 6673
90 Ga0207674_10907104 3300026116 Bacteria 849
91 Ga0207675_100061704 3300026118 Unclassified 3499
92 Ga0207428_10000669 3300027907 Bacteria 40037
93 Ga0265316_10056505 3300031344 Bacteria 3064
94 Ga0307412_10926220 3300031911 Bacteria 765
95 Ga0307416_101373947 3300032002 Bacteria 812
96 Ga0373932_0000496 3300035112 Bacteria 12133
97 Ga0373941_0055684 3300035115 Unclassified 1272
98 Ga0373941_0227801 3300035115 Bacteria 719
99 Ga0373947_0509658 3300035725 Unclassified 818
100 Ga0436365_0509084 3300039437 Bacteria 8937
101 Ga0436365_0774883 3300039437 Bacteria 390569
102 Ga0436362_0660519 3300039453 Bacteria 832172
103 Ga0453684_0874790 3300044712 Unclassified 964
104 Ga0495620_0008788 3300046515 Bacteria 5407
105 Ga0501032_0139992 3300049569 Bacteria 1594
106 Ga0501037_0308526 3300049573 Bacteria 1097
107 Ga0501038_0538510 3300049574 Bacteria 889
108 Ga0501039_0376067 3300049575 Bacteria 1116
109 Ga0501073_0004246 3300049589 Bacteria 10743
110 Ga0501073_0086382 3300049589 Bacteria 2182
111 Ga0501073_0407758 3300049589 Bacteria 939
112 Ga0501079_0822620 3300049741 Bacteria 731
113 Ga0501080_0454239 3300049742 Bacteria 1148
114 Ga0501080_0834546 3300049742 Bacteria 807
115 nmdc:mga09592_869788_c1 3300050508 Bacteria 759
116 nmdc:mga06r32_2659_c1 3300050510 Bacteria 15972
117 nmdc:mga08y16_393_c1 3300050511 Bacteria 40037
118 nmdc:mga0n895_347246_c1 3300050512 Bacteria 1503
119 nmdc:mga0n895_409730_c1 3300050512 Bacteria 1371
120 nmdc:mga0rr50_84_c1 3300050513 Bacteria 52823
121 nmdc:mga0rr50_92999_c1 3300050513 Bacteria 2352
122 nmdc:mga08x19_416_c1 3300050514 Bacteria 25305
123 Ga0495655_0000289 3300053083 Bacteria 9182
124 Ga0495655_0015544 3300053083 Bacteria 1620
125 Ga0501084_0006751 3300054114 Bacteria 9435
126 Ga0501082_0506915 3300060353 Bacteria 1055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100010149 Ga0070689_1000101495 160
2 3300005842 Ga0068858_100000717 Ga0068858_10000071729 160
3 3300006881 Ga0068865_100026361 Ga0068865_1000263615 160
4 3300009098 Ga0105245_10090120 Ga0105245_100901205 160
5 3300025927 Ga0207687_10020422 Ga0207687_100204222 160
6 3300025936 Ga0207670_10000628 Ga0207670_100006285 160
7 3300025938 Ga0207704_10022802 Ga0207704_100228023 160
8 3300026035 Ga0207703_10003486 Ga0207703_1000348612 160
9 3300005329 Ga0070683_100265076 Ga0070683_1002650763 166
10 3300005535 Ga0070684_100267866 Ga0070684_1002678662 166
11 3300009094 Ga0111539_10102302 Ga0111539_101023023 172
12 3300031344 Ga0265316_10056505 Ga0265316_100565054 172
13 3300005471 Ga0070698_100141721 Ga0070698_1001417213 174
14 3300009553 Ga0105249_10502397 Ga0105249_105023973 175
15 3300005441 Ga0070700_100000078 Ga0070700_10000007852 176
16 3300013297 Ga0157378_10157143 Ga0157378_101571433 176
17 3300005333 Ga0070677_10162927 Ga0070677_101629272 177
18 3300005337 Ga0070682_100000035 Ga0070682_10000003590 177
19 3300005436 Ga0070713_100047690 Ga0070713_1000476903 177
20 3300005445 Ga0070708_101003720 Ga0070708_1010037201 177
21 3300005467 Ga0070706_100003880 Ga0070706_1000038808 177
22 3300005467 Ga0070706_100495651 Ga0070706_1004956512 177
23 3300005468 Ga0070707_100018583 Ga0070707_1000185834 177
24 3300005518 Ga0070699_100010866 Ga0070699_1000108666 177
25 3300005539 Ga0068853_101187755 Ga0068853_1011877551 177
26 3300005543 Ga0070672_100000360 Ga0070672_10000036023 177
27 3300005618 Ga0068864_100000007 Ga0068864_100000007121 177
28 3300005842 Ga0068858_100547805 Ga0068858_1005478053 177
29 3300006028 Ga0070717_10875035 Ga0070717_108750352 177
30 3300009093 Ga0105240_10762414 Ga0105240_107624142 177
31 3300013105 Ga0157369_10838110 Ga0157369_108381102 177
32 3300013297 Ga0157378_10002183 Ga0157378_1000218311 177
33 3300013308 Ga0157375_10000003 Ga0157375_10000003263 177
34 3300014326 Ga0157380_10001100 Ga0157380_100011005 177
35 3300025913 Ga0207695_10208050 Ga0207695_102080502 177
36 3300025922 Ga0207646_10019065 Ga0207646_100190656 177
37 3300025940 Ga0207691_10002666 Ga0207691_100026665 177
38 3300026035 Ga0207703_10654401 Ga0207703_106544012 177
39 3300026041 Ga0207639_10000003 Ga0207639_10000003287 177
40 3300026095 Ga0207676_10000015 Ga0207676_10000015209 177
41 3300035115 Ga0373941_0055684 Ga0373941_0055684_108_641 177
42 3300049589 Ga0501073_0086382 Ga0501073_0086382_691_1281 177
43 3300049589 Ga0501073_0407758 Ga0501073_0407758_51_641 177
44 3300054114 Ga0501084_0006751 Ga0501084_0006751_7140_7730 177
45 3300005577 Ga0068857_100053805 Ga0068857_1000538053 178
46 3300005719 Ga0068861_100804635 Ga0068861_1008046352 178
47 3300006028 Ga0070717_10000062 Ga0070717_1000006238 178
48 3300006173 Ga0070716_100744029 Ga0070716_1007440292 178
49 3300013306 Ga0163162_11169543 Ga0163162_111695432 178
50 3300021384 Ga0213876_10004055 Ga0213876_100040554 178
51 3300025928 Ga0207700_10102345 Ga0207700_101023454 178
52 3300026089 Ga0207648_10999573 Ga0207648_109995731 178
53 3300026116 Ga0207674_10023073 Ga0207674_100230738 178
54 3300039437 Ga0436365_0509084 Ga0436365_0509084_2862_3401 178
55 3300049569 Ga0501032_0139992 Ga0501032_0139992_624_1217 178
56 3300049573 Ga0501037_0308526 Ga0501037_0308526_86_679 178
57 3300049574 Ga0501038_0538510 Ga0501038_0538510_193_786 178
58 3300049575 Ga0501039_0376067 Ga0501039_0376067_296_889 178
59 3300049742 Ga0501080_0454239 Ga0501080_0454239_309_902 178
60 3300053083 Ga0495655_0000289 Ga0495655_0000289_717_1253 178
61 3300005336 Ga0070680_100027865 Ga0070680_1000278653 179
62 3300005434 Ga0070709_10447842 Ga0070709_104478421 179
63 3300005437 Ga0070710_10119880 Ga0070710_101198804 179
64 3300005468 Ga0070707_100065183 Ga0070707_1000651833 179
65 3300005719 Ga0068861_100091957 Ga0068861_1000919572 179
66 3300006173 Ga0070716_100169362 Ga0070716_1001693622 179
67 3300007076 Ga0075435_100000070 Ga0075435_10000007045 179
68 3300007076 Ga0075435_100111448 Ga0075435_1001114485 179
69 3300021358 Ga0213873_10000002 Ga0213873_10000002591 179
70 3300021384 Ga0213876_10000001 Ga0213876_10000001674 179
71 3300025898 Ga0207692_10271189 Ga0207692_102711892 179
72 3300025910 Ga0207684_10080309 Ga0207684_100803091 179
73 3300025917 Ga0207660_10042623 Ga0207660_100426233 179
74 3300025922 Ga0207646_10039710 Ga0207646_100397104 179
75 3300025939 Ga0207665_10198830 Ga0207665_101988302 179
76 3300025944 Ga0207661_10268764 Ga0207661_102687643 179
77 3300026118 Ga0207675_100061704 Ga0207675_1000617044 179
78 3300035115 Ga0373941_0227801 Ga0373941_0227801_94_636 179
79 3300035725 Ga0373947_0509658 Ga0373947_0509658_132_686 179
80 3300039437 Ga0436365_0774883 Ga0436365_0774883_143092_143631 179
81 3300039453 Ga0436362_0660519 Ga0436362_0660519_339650_340189 179
82 3300050513 nmdc:mga0rr50_84_c1 nmdc:mga0rr50_84_c1_16796_17335 179
83 3300050513 nmdc:mga0rr50_92999_c1 nmdc:mga0rr50_92999_c1_1568_2110 179
84 3300050514 nmdc:mga08x19_416_c1 nmdc:mga08x19_416_c1_12912_13451 179
85 3300005327 Ga0070658_10295458 Ga0070658_102954581 180
86 3300005340 Ga0070689_100257324 Ga0070689_1002573242 180
87 3300005354 Ga0070675_100000002 Ga0070675_100000002252 180
88 3300005355 Ga0070671_100122925 Ga0070671_1001229253 180
89 3300005466 Ga0070685_10147903 Ga0070685_101479033 180
90 3300005615 Ga0070702_100082118 Ga0070702_1000821183 180
91 3300005840 Ga0068870_10419469 Ga0068870_104194691 180
92 3300006844 Ga0075428_100001909 Ga0075428_10000190912 180
93 3300006847 Ga0075431_100004486 Ga0075431_10000448614 180
94 3300006871 Ga0075434_100454638 Ga0075434_1004546382 180
95 3300006880 Ga0075429_100544950 Ga0075429_1005449501 180
96 3300009094 Ga0111539_10000837 Ga0111539_1000083740 180
97 3300009176 Ga0105242_10005722 Ga0105242_100057225 180
98 3300014745 Ga0157377_10000126 Ga0157377_1000012630 180
99 3300025908 Ga0207643_10360405 Ga0207643_103604052 180
100 3300025918 Ga0207662_10295434 Ga0207662_102954342 180
101 3300025926 Ga0207659_10000005 Ga0207659_10000005277 180
102 3300025934 Ga0207686_10009919 Ga0207686_100099195 180
103 3300025942 Ga0207689_10143784 Ga0207689_101437843 180
104 3300026075 Ga0207708_10000018 Ga0207708_1000001853 180
105 3300026116 Ga0207674_10907104 Ga0207674_109071042 180
106 3300027907 Ga0207428_10000669 Ga0207428_1000066940 180
107 3300031911 Ga0307412_10926220 Ga0307412_109262202 180
108 3300032002 Ga0307416_101373947 Ga0307416_1013739471 180
109 3300035112 Ga0373932_0000496 Ga0373932_0000496_6900_7442 180
110 3300044712 Ga0453684_0874790 Ga0453684_0874790_47_589 180
111 3300046515 Ga0495620_0008788 Ga0495620_0008788_2594_3136 180
112 3300049589 Ga0501073_0004246 Ga0501073_0004246_743_1294 180
113 3300049741 Ga0501079_0822620 Ga0501079_0822620_150_692 180
114 3300050508 nmdc:mga09592_869788_c1 nmdc:mga09592_869788_c1_63_605 180
115 3300050510 nmdc:mga06r32_2659_c1 nmdc:mga06r32_2659_c1_7215_7757 180
116 3300050511 nmdc:mga08y16_393_c1 nmdc:mga08y16_393_c1_39328_39870 180
117 3300050512 nmdc:mga0n895_409730_c1 nmdc:mga0n895_409730_c1_187_729 180
118 3300053083 Ga0495655_0015544 Ga0495655_0015544_94_636 180
119 3300060353 Ga0501082_0506915 Ga0501082_0506915_314_856 180
120 3300006871 Ga0075434_100664104 Ga0075434_1006641043 181
121 3300014968 Ga0157379_10525658 Ga0157379_105256582 181
122 3300049742 Ga0501080_0834546 Ga0501080_0834546_126_731 181
123 3300050512 nmdc:mga0n895_347246_c1 nmdc:mga0n895_347246_c1_549_1094 181
124 3300005615 Ga0070702_100307002 Ga0070702_1003070023 182
125 3300005616 Ga0068852_101163260 Ga0068852_1011632602 182
126 3300005295 Ga0065707_10094750 Ga0065707_100947505 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

125

174

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

119

172

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

29

96

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9712 117 177
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9686 131 170
8hnp-assembly1.cif.gz_B archaeal transcription factor mutant 0.966 129 176
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9563 129 177
7vim-assembly1.cif.gz_A the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9502 129 177
ID Description Score Start End Superfamily
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9766 117 177 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 117 177 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9712 117 177 1.10.10.10
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9686 131 170 1.10.10.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9467 120 173 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4V4HP26-F1-model_v4 RNA polymerase sigma factor 0.7238 12 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A524NCG0-F1-model_v4 RNA polymerase sigma factor 0.7177 11 176 GO:0003677
GO:0006352
GO:0016987
AF-A0A6L3VQ72-F1-model_v4 SigE family RNA polymerase sigma factor 0.6966 19 174 GO:0003677
GO:0006352
GO:0016987
AF-A0A7V0UI03-F1-model_v4 RNA polymerase sigma factor 0.6895 11 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A524NCG0-F1-model_v4 RNA polymerase sigma factor 0.6879 11 176 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
81.51 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map