F128308

General Info

Members Datasets Scaffolds Average Seq Length
125 58 125 147

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_1106773_c1|nmdc:mga06r32_1106773_c1_178_615
Length 145
Sequence MRPSLSLLLFATAGLVVAFAPLPVRSVAPQERTFQIDARQYAYSPSELLVNPGDIVTFELVSNDVVHGLYVDGYGISVEADPGQTATLTFVADRPGSFRCNVTCGAMHPFMIGKLTVGANHWLYRGIGLAILAALGVLIWTKRKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
35 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
36 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
37 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
38 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
39 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
40 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
41 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
42 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
43 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
44 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
45 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
46 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
47 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
48 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
49 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
50 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
51 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
52 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
53 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
54 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
55 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
56 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
57 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
58 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.8
Rhizosphere 99.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1644097 2162886007 Unclassified 1132
2 SwRhRL2b_contig_2570417 2162886007 Bacteria 2577
3 MBSR1b_contig_12976549 2162886012 Unclassified 892
4 Ga0065704_10077697 3300005289 Bacteria 4650
5 Ga0065704_10170468 3300005289 Bacteria 1295
6 Ga0065707_10044665 3300005295 Unclassified 923
7 Ga0065707_10083978 3300005295 Bacteria 7870
8 Ga0065707_10085802 3300005295 Bacteria 5872
9 Ga0065707_10100003 3300005295 Unclassified 2962
10 Ga0065707_10492456 3300005295 Unclassified 764
11 Ga0065707_10593857 3300005295 Unclassified 694
12 Ga0070689_100709287 3300005340 Unclassified 879
13 Ga0070687_101190123 3300005343 Unclassified 561
14 Ga0070700_100397374 3300005441 Bacteria 1035
15 Ga0070698_100331684 3300005471 Bacteria 1452
16 Ga0070686_100125914 3300005544 Unclassified 1765
17 Ga0070704_101321045 3300005549 Bacteria 660
18 Ga0068859_100074207 3300005617 Unclassified 3440
19 Ga0068864_100357985 3300005618 Bacteria 1378
20 Ga0068864_100373237 3300005618 Bacteria 1350
21 Ga0068861_100698600 3300005719 Bacteria 942
22 Ga0068870_10540420 3300005840 Unclassified 783
23 Ga0068858_100840826 3300005842 Unclassified 896
24 Ga0068862_100457493 3300005844 Bacteria 1204
25 Ga0075428_100053977 3300006844 Bacteria 4404
26 Ga0075431_100248686 3300006847 Bacteria 1807
27 Ga0075431_100554973 3300006847 Bacteria 1136
28 Ga0075433_10978861 3300006852 Bacteria 737
29 Ga0075433_11252514 3300006852 Unclassified 643
30 Ga0075429_100001240 3300006880 Bacteria 20684
31 Ga0075429_100160206 3300006880 Bacteria 1970
32 Ga0075429_100693954 3300006880 Unclassified 892
33 Ga0097620_100074213 3300006931 Unclassified 3440
34 Ga0114129_10001103 3300009147 Bacteria 35502
35 Ga0114129_10140381 3300009147 Bacteria 3312
36 Ga0105249_10025851 3300009553 Bacteria 5288
37 Ga0105246_10104336 3300011119 Bacteria 2070
38 Ga0207670_11334087 3300025936 Bacteria 609
39 Ga0207712_10044040 3300025961 Unclassified 3082
40 Ga0207708_10395464 3300026075 Bacteria 1142
41 Ga0207675_101103964 3300026118 Bacteria 813
42 Ga0268265_10269919 3300028380 Bacteria 1517
43 Ga0307405_10367198 3300031731 Unclassified 1116
44 Ga0307410_10493717 3300031852 Bacteria 1006
45 Ga0307412_10539695 3300031911 Unclassified 978
46 Ga0307415_101154287 3300032126 Unclassified 728
47 Ga0307415_101527286 3300032126 Unclassified 640
48 Ga0373948_0165744 3300034817 Unclassified 560
49 Ga0373932_0117028 3300035112 Bacteria 885
50 Ga0451577_0001346 3300042876 Bacteria 33277
51 Ga0451577_0003319 3300042876 Bacteria 18081
52 Ga0451577_0004163 3300042876 Bacteria 15484
53 Ga0451577_0119930 3300042876 Bacteria 2356
54 Ga0451577_0152768 3300042876 Bacteria 2077
55 Ga0451577_0217369 3300042876 Bacteria 1727
56 Ga0451577_0316807 3300042876 Bacteria 1414
57 Ga0451577_0326165 3300042876 Bacteria 1392
58 Ga0451577_0446727 3300042876 Bacteria 1174
59 Ga0451577_0647721 3300042876 Bacteria 958
60 Ga0453683_0018148 3300044673 Unclassified 4519
61 Ga0453683_0147045 3300044673 Unclassified 1488
62 Ga0453683_0199241 3300044673 Bacteria 1271
63 Ga0453683_0265107 3300044673 Bacteria 1096
64 Ga0453683_0705069 3300044673 Unclassified 661
65 Ga0453683_0905298 3300044673 Bacteria 583
66 Ga0453684_0000035 3300044712 Bacteria 725956
67 Ga0453684_0000106 3300044712 Bacteria 364365
68 Ga0453684_0000128 3300044712 Bacteria 335864
69 Ga0453684_0000169 3300044712 Bacteria 289762
70 Ga0453684_0000973 3300044712 Bacteria 94244
71 Ga0453684_0003192 3300044712 Bacteria 37568
72 Ga0453684_0003827 3300044712 Bacteria 33190
73 Ga0453684_0007661 3300044712 Bacteria 19753
74 Ga0453684_0008662 3300044712 Bacteria 18099
75 Ga0453684_0014977 3300044712 Bacteria 12317
76 Ga0453684_0016718 3300044712 Bacteria 11441
77 Ga0453684_0025624 3300044712 Bacteria 8557
78 Ga0453684_0063462 3300044712 Bacteria 4725
79 Ga0453684_0086415 3300044712 Unclassified 3892
80 Ga0453684_0096322 3300044712 Bacteria 3636
81 Ga0453684_0113517 3300044712 Bacteria 3286
82 Ga0453684_0129929 3300044712 Bacteria 3024
83 Ga0453684_0640452 3300044712 Bacteria 1161
84 Ga0453684_0663190 3300044712 Bacteria 1137
85 Ga0453684_0680931 3300044712 Unclassified 1119
86 Ga0453684_0711179 3300044712 Bacteria 1091
87 Ga0453684_0742811 3300044712 Bacteria 1063
88 Ga0453684_0749931 3300044712 Bacteria 1057
89 Ga0453684_0802686 3300044712 Unclassified 1015
90 Ga0453684_0821029 3300044712 Unclassified 1001
91 Ga0453684_0872276 3300044712 Unclassified 966
92 Ga0453684_0906442 3300044712 Bacteria 944
93 Ga0453684_1393610 3300044712 Unclassified 727
94 Ga0453684_1636032 3300044712 Bacteria 660
95 Ga0453684_1696915 3300044712 Unclassified 645
96 Ga0451576_0000152 3300045051 Bacteria 176305
97 Ga0451576_0012319 3300045051 Bacteria 9615
98 Ga0451576_0168668 3300045051 Unclassified 2285
99 Ga0451576_0601896 3300045051 Unclassified 1155
100 Ga0451576_0688372 3300045051 Unclassified 1074
101 Ga0451576_1106021 3300045051 Unclassified 829
102 Ga0496108_1316946 3300048911 Unclassified 607
103 Ga0501299_028186 3300049522 Unclassified 1069
104 Ga0501048_0310157 3300049582 Unclassified 1123
105 Ga0501068_0538619 3300049584 Unclassified 759
106 Ga0501074_0302080 3300049590 Unclassified 1137
107 Ga0501076_0064626 3300049592 Bacteria 2917
108 Ga0501076_0182950 3300049592 Unclassified 1709
109 Ga0501077_0395139 3300049593 Unclassified 884
110 Ga0501243_070442 3300049675 Unclassified 664
111 Ga0501257_146906 3300049686 Unclassified 648
112 Ga0501079_0461135 3300049741 Unclassified 998
113 Ga0501081_0075944 3300049743 Bacteria 2346
114 Ga0501045_0588391 3300049824 Unclassified 824
115 Ga0501045_1215807 3300049824 Unclassified 550
116 nmdc:mga05p37_181086_c1 3300050507 Unclassified 2563
117 nmdc:mga05p37_759_c1 3300050507 Bacteria 35838
118 nmdc:mga09592_1130_c1 3300050508 Bacteria 21224
119 nmdc:mga09592_51550_c1 3300050508 Bacteria 3472
120 nmdc:mga0qj67_421276_c1 3300050509 Unclassified 1076
121 nmdc:mga06r32_1106773_c1 3300050510 Unclassified 741
122 nmdc:mga0a205_548364_c1 3300050515 Unclassified 1011
123 Ga0501084_0074462 3300054114 Unclassified 2843
124 Ga0501084_0218472 3300054114 Bacteria 1608
125 Ga0530510_0519567 3300061734 Unclassified 903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0647721 Ga0451577_0647721_499_906 135
2 3300044712 Ga0453684_0014977 Ga0453684_0014977_9315_9722 135
3 3300044712 Ga0453684_0063462 Ga0453684_0063462_2577_2984 135
4 3300044712 Ga0453684_0680931 Ga0453684_0680931_512_919 135
5 3300005295 Ga0065707_10085802 Ga0065707_100858022 136
6 3300009147 Ga0114129_10140381 Ga0114129_101403814 136
7 3300042876 Ga0451577_0001346 Ga0451577_0001346_6711_7121 136
8 3300042876 Ga0451577_0316807 Ga0451577_0316807_215_625 136
9 3300044673 Ga0453683_0199241 Ga0453683_0199241_175_585 136
10 3300044712 Ga0453684_0000973 Ga0453684_0000973_67693_68103 136
11 3300044712 Ga0453684_0007661 Ga0453684_0007661_1523_1933 136
12 3300044712 Ga0453684_0086415 Ga0453684_0086415_1302_1733 136
13 3300044712 Ga0453684_0113517 Ga0453684_0113517_1037_1447 136
14 3300044712 Ga0453684_0640452 Ga0453684_0640452_82_510 136
15 3300045051 Ga0451576_0012319 Ga0451576_0012319_6095_6505 136
16 3300048911 Ga0496108_1316946 Ga0496108_1316946_27_437 136
17 3300049584 Ga0501068_0538619 Ga0501068_0538619_171_611 136
18 3300049592 Ga0501076_0182950 Ga0501076_0182950_430_870 136
19 3300049824 Ga0501045_1215807 Ga0501045_1215807_87_527 136
20 3300005544 Ga0070686_100125914 Ga0070686_1001259142 137
21 3300044712 Ga0453684_1696915 Ga0453684_1696915_37_486 137
22 3300025936 Ga0207670_11334087 Ga0207670_113340871 142
23 3300006847 Ga0075431_100248686 Ga0075431_1002486862 144
24 3300044712 Ga0453684_1636032 Ga0453684_1636032_24_476 144
25 3300049675 Ga0501243_070442 Ga0501243_070442_122_559 144
26 3300050510 nmdc:mga06r32_1106773_c1 nmdc:mga06r32_1106773_c1_178_615 144
27 3300044712 Ga0453684_0821029 Ga0453684_0821029_400_855 145
28 3300049590 Ga0501074_0302080 Ga0501074_0302080_643_1083 145
29 3300049592 Ga0501076_0064626 Ga0501076_0064626_804_1244 145
30 3300049593 Ga0501077_0395139 Ga0501077_0395139_85_525 145
31 3300049741 Ga0501079_0461135 Ga0501079_0461135_374_814 145
32 3300049743 Ga0501081_0075944 Ga0501081_0075944_536_976 145
33 3300049824 Ga0501045_0588391 Ga0501045_0588391_298_738 145
34 3300054114 Ga0501084_0074462 Ga0501084_0074462_192_632 145
35 3300054114 Ga0501084_0218472 Ga0501084_0218472_570_1010 145
36 3300061734 Ga0530510_0519567 Ga0530510_0519567_254_694 145
37 2162886007 SwRhRL2b_contig_1644097 SwRhRL2b_0699.00001610 146
38 2162886007 SwRhRL2b_contig_2570417 SwRhRL2b_0673.00008060 146
39 2162886012 MBSR1b_contig_12976549 MBSR1b_0058.00003000 146
40 3300005289 Ga0065704_10077697 Ga0065704_100776974 146
41 3300005289 Ga0065704_10170468 Ga0065704_101704682 146
42 3300005295 Ga0065707_10044665 Ga0065707_100446651 146
43 3300005295 Ga0065707_10083978 Ga0065707_100839788 146
44 3300005295 Ga0065707_10100003 Ga0065707_101000035 146
45 3300005295 Ga0065707_10492456 Ga0065707_104924562 146
46 3300005295 Ga0065707_10593857 Ga0065707_105938571 146
47 3300005340 Ga0070689_100709287 Ga0070689_1007092872 146
48 3300005343 Ga0070687_101190123 Ga0070687_1011901231 146
49 3300005441 Ga0070700_100397374 Ga0070700_1003973742 146
50 3300005471 Ga0070698_100331684 Ga0070698_1003316842 146
51 3300005549 Ga0070704_101321045 Ga0070704_1013210451 146
52 3300005617 Ga0068859_100074207 Ga0068859_1000742075 146
53 3300005618 Ga0068864_100357985 Ga0068864_1003579852 146
54 3300005618 Ga0068864_100373237 Ga0068864_1003732372 146
55 3300005719 Ga0068861_100698600 Ga0068861_1006986001 146
56 3300005840 Ga0068870_10540420 Ga0068870_105404202 146
57 3300005842 Ga0068858_100840826 Ga0068858_1008408261 146
58 3300005844 Ga0068862_100457493 Ga0068862_1004574932 146
59 3300006844 Ga0075428_100053977 Ga0075428_1000539774 146
60 3300006847 Ga0075431_100554973 Ga0075431_1005549732 146
61 3300006852 Ga0075433_10978861 Ga0075433_109788611 146
62 3300006852 Ga0075433_11252514 Ga0075433_112525142 146
63 3300006880 Ga0075429_100001240 Ga0075429_1000012407 146
64 3300006880 Ga0075429_100160206 Ga0075429_1001602062 146
65 3300006880 Ga0075429_100693954 Ga0075429_1006939542 146
66 3300006931 Ga0097620_100074213 Ga0097620_1000742132 146
67 3300009147 Ga0114129_10001103 Ga0114129_1000110332 146
68 3300009553 Ga0105249_10025851 Ga0105249_100258515 146
69 3300011119 Ga0105246_10104336 Ga0105246_101043362 146
70 3300025961 Ga0207712_10044040 Ga0207712_100440405 146
71 3300026075 Ga0207708_10395464 Ga0207708_103954642 146
72 3300026118 Ga0207675_101103964 Ga0207675_1011039642 146
73 3300028380 Ga0268265_10269919 Ga0268265_102699192 146
74 3300031731 Ga0307405_10367198 Ga0307405_103671982 146
75 3300031852 Ga0307410_10493717 Ga0307410_104937172 146
76 3300031911 Ga0307412_10539695 Ga0307412_105396952 146
77 3300032126 Ga0307415_101154287 Ga0307415_1011542872 146
78 3300032126 Ga0307415_101527286 Ga0307415_1015272862 146
79 3300034817 Ga0373948_0165744 Ga0373948_0165744_107_550 146
80 3300035112 Ga0373932_0117028 Ga0373932_0117028_238_681 146
81 3300042876 Ga0451577_0003319 Ga0451577_0003319_12384_12833 146
82 3300042876 Ga0451577_0004163 Ga0451577_0004163_10776_11219 146
83 3300042876 Ga0451577_0119930 Ga0451577_0119930_128_571 146
84 3300042876 Ga0451577_0152768 Ga0451577_0152768_1598_2041 146
85 3300042876 Ga0451577_0217369 Ga0451577_0217369_744_1187 146
86 3300042876 Ga0451577_0326165 Ga0451577_0326165_545_988 146
87 3300042876 Ga0451577_0446727 Ga0451577_0446727_444_941 146
88 3300044673 Ga0453683_0018148 Ga0453683_0018148_189_650 146
89 3300044673 Ga0453683_0147045 Ga0453683_0147045_137_580 146
90 3300044673 Ga0453683_0265107 Ga0453683_0265107_601_1044 146
91 3300044673 Ga0453683_0705069 Ga0453683_0705069_138_581 146
92 3300044673 Ga0453683_0905298 Ga0453683_0905298_58_540 146
93 3300044712 Ga0453684_0000035 Ga0453684_0000035_454457_454906 146
94 3300044712 Ga0453684_0000106 Ga0453684_0000106_73581_74024 146
95 3300044712 Ga0453684_0000128 Ga0453684_0000128_93445_93906 146
96 3300044712 Ga0453684_0000169 Ga0453684_0000169_11512_11973 146
97 3300044712 Ga0453684_0003192 Ga0453684_0003192_33583_34044 146
98 3300044712 Ga0453684_0003827 Ga0453684_0003827_5285_5728 146
99 3300044712 Ga0453684_0008662 Ga0453684_0008662_14920_15363 146
100 3300044712 Ga0453684_0016718 Ga0453684_0016718_5410_5853 146
101 3300044712 Ga0453684_0025624 Ga0453684_0025624_1002_1445 146
102 3300044712 Ga0453684_0096322 Ga0453684_0096322_1060_1503 146
103 3300044712 Ga0453684_0129929 Ga0453684_0129929_2258_2701 146
104 3300044712 Ga0453684_0663190 Ga0453684_0663190_186_647 146
105 3300044712 Ga0453684_0711179 Ga0453684_0711179_510_956 146
106 3300044712 Ga0453684_0742811 Ga0453684_0742811_84_533 146
107 3300044712 Ga0453684_0749931 Ga0453684_0749931_365_835 146
108 3300044712 Ga0453684_0802686 Ga0453684_0802686_413_877 146
109 3300044712 Ga0453684_0872276 Ga0453684_0872276_326_769 146
110 3300044712 Ga0453684_0906442 Ga0453684_0906442_200_664 146
111 3300044712 Ga0453684_1393610 Ga0453684_1393610_165_608 146
112 3300045051 Ga0451576_0000152 Ga0451576_0000152_56159_56620 146
113 3300045051 Ga0451576_0168668 Ga0451576_0168668_639_1082 146
114 3300045051 Ga0451576_0601896 Ga0451576_0601896_117_560 146
115 3300045051 Ga0451576_0688372 Ga0451576_0688372_572_1036 146
116 3300045051 Ga0451576_1106021 Ga0451576_1106021_182_622 146
117 3300049522 Ga0501299_028186 Ga0501299_028186_418_858 146
118 3300049582 Ga0501048_0310157 Ga0501048_0310157_335_817 146
119 3300049686 Ga0501257_146906 Ga0501257_146906_100_540 146
120 3300050507 nmdc:mga05p37_181086_c1 nmdc:mga05p37_181086_c1_459_938 146
121 3300050507 nmdc:mga05p37_759_c1 nmdc:mga05p37_759_c1_5338_5781 146
122 3300050508 nmdc:mga09592_1130_c1 nmdc:mga09592_1130_c1_15772_16215 146
123 3300050508 nmdc:mga09592_51550_c1 nmdc:mga09592_51550_c1_216_680 146
124 3300050509 nmdc:mga0qj67_421276_c1 nmdc:mga0qj67_421276_c1_31_495 146
125 3300050515 nmdc:mga0a205_548364_c1 nmdc:mga0a205_548364_c1_81_563 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

26

117

0.88

PF13473

Cupredoxin_1

Cupredoxin-like domain

7

117

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aq5-assembly1.cif.gz_A pseudomonas stutzeri nitrous oxide reductase mutant, h583n 0.9278 35 118
6y77-assembly1.cif.gz_A pseudomonas stutzeri nitrous oxide reductase mutant, h326a 0.9277 35 118
7aq3-assembly1.cif.gz_A pseudomonas stutzeri nitrous oxide reductase mutant, h583d 0.9276 35 118
7aqa-assembly1.cif.gz_A pseudomonas stutzeri nitrous oxide reductase mutant, h382a 0.9275 35 118
5i5m-assembly1.cif.gz_A shewanella denitrificans nitrous oxide reductase, ca2+-reconstituted form 0.9272 35 118
ID Description Score Start End Superfamily
5i5jB02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8875 35 119 2.60.40.420
af_K7N4E4_8_138_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8749 51 103 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8689 31 119 2.60.40.420
1ibyB00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8667 41 120 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8506 31 119 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7J4JJA4-F1-model_v4 Cytochrome c oxidase subunit II 0.945 30 119 GO:0004129
GO:0005507
GO:0016020
AF-A0A3M1DMG6-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9398 30 119 GO:0004129
GO:0005507
GO:0016020
AF-A0A0G0YD06-F1-model_v4 Cytochrome c oxidase subunit II 0.9343 26 120 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A1G1N8E5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9339 30 119 GO:0004129
GO:0005507
GO:0016020
AF-A0A2D6ILP7-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9334 32 119 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.01 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map