F128138

General Info

Members Datasets Scaffolds Average Seq Length
125 65 250 263

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0191441|Ga0501036_0191441_81_953
Length 290
Sequence MPVDGLKDAIPLHTTWHKIAHVIILRMPPRTKKEKEIEPVVGPVEPALPIEQPIRQEDTVTFKRSHFYAVLVVLAFAAGILTGYVTWGVGSTGEPAQTASQAGGPVVEEEPQYVRYDVPVEGAYALGPENAPITIVEFSDFQCPYCRRWHEQVYEPLLAAYPGKIRMVYRHLPLTSIHPDAFPAAEAAMCAGEQDAFWPYHEKLFSNEALGSEVYTRYAEELSLNMNAFESCMIGHKYQEAIQSDIDFAFNLGIRSTPTFFVNGLAIVGAQPLEVFQQLIGKELAGEIPD

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
49 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
53 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
54 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
57 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
58 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
59 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
60 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
61 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
62 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
63 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
64 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
65 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 23.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0191441 3300049572 Bacteria 1721
2 JGI25406J46586_10000277 3300003203 Bacteria 22810
3 Ga0065707_10010991 3300005295 Bacteria 3164
4 Ga0065707_10083939 3300005295 Bacteria 7929
5 Ga0065707_10088537 3300005295 Unclassified 4630
6 Ga0065707_10107260 3300005295 Bacteria 2560
7 Ga0070689_100079468 3300005340 Bacteria 2573
8 Ga0070706_100010578 3300005467 Bacteria 8560
9 Ga0070707_100172136 3300005468 Bacteria 2110
10 Ga0070707_100221383 3300005468 Bacteria 1843
11 Ga0070698_100031801 3300005471 Bacteria 5469
12 Ga0070698_100390016 3300005471 Bacteria 1325
13 Ga0070698_100392047 3300005471 Unclassified 1322
14 Ga0070699_100001435 3300005518 Bacteria 21888
15 Ga0070699_100004257 3300005518 Bacteria 12658
16 Ga0070699_100115201 3300005518 Bacteria 2362
17 Ga0070695_100062570 3300005545 Unclassified 2417
18 Ga0070695_100317322 3300005545 Unclassified 1157
19 Ga0070704_100045663 3300005549 Bacteria 3049
20 Ga0068857_100335447 3300005577 Unclassified 1398
21 Ga0068862_100153865 3300005844 Unclassified 2048
22 Ga0081539_10000947 3300005985 Bacteria 54424
23 Ga0075428_100076202 3300006844 Bacteria 3662
24 Ga0075430_100337520 3300006846 Unclassified 1245
25 Ga0075433_10024294 3300006852 Bacteria 5113
26 Ga0075429_100004697 3300006880 Bacteria 11754
27 Ga0075429_100030252 3300006880 Bacteria 4704
28 Ga0075429_100046830 3300006880 Bacteria 3762
29 Ga0075429_100395205 3300006880 Unclassified 1211
30 Ga0111539_10203144 3300009094 Unclassified 2310
31 Ga0114129_10002393 3300009147 Bacteria 26068
32 Ga0114129_10181462 3300009147 Bacteria 2863
33 Ga0114129_10368099 3300009147 Bacteria 1900
34 Ga0114129_10483641 3300009147 Bacteria 1619
35 Ga0114129_11574438 3300009147 Bacteria 805
36 Ga0105243_10165745 3300009148 Bacteria 1909
37 Ga0105242_10368400 3300009176 Unclassified 1332
38 Ga0105246_10040408 3300011119 Bacteria 3148
39 Ga0207684_10088086 3300025910 Unclassified 2645
40 Ga0207708_10045837 3300026075 Bacteria 3332
41 Ga0207676_10289923 3300026095 Bacteria 1490
42 Ga0207674_10263591 3300026116 Unclassified 1670
43 Ga0268265_10125273 3300028380 Bacteria 2125
44 Ga0268265_10145968 3300028380 Bacteria 1988
45 Ga0265318_10005949 3300028577 Bacteria 5668
46 Ga0265338_10071574 3300028800 Bacteria 2965
47 Ga0265328_10049040 3300031239 Bacteria 1551
48 Ga0265320_10021278 3300031240 Bacteria 3494
49 Ga0265340_10013170 3300031247 Unclassified 4352
50 Ga0265340_10054422 3300031247 Unclassified 1930
51 Ga0265331_10004401 3300031250 Bacteria 8806
52 Ga0265316_10161750 3300031344 Bacteria 1673
53 Ga0316579_10026628 3300031691 Unclassified 2620
54 Ga0265342_10080498 3300031712 Unclassified 1882
55 Ga0307405_10092570 3300031731 Bacteria 2006
56 Ga0307413_10218116 3300031824 Bacteria 1391
57 Ga0307407_10104762 3300031903 Bacteria 1763
58 Ga0307412_10056670 3300031911 Bacteria 2613
59 Ga0307416_100283014 3300032002 Bacteria 1636
60 Ga0307416_100639375 3300032002 Unclassified 1148
61 Ga0316584_0180403 3300036712 Unclassified 1563
62 Ga0316581_0009945 3300037588 Unclassified 2626
63 Ga0451577_0003280 3300042876 Bacteria 18210
64 Ga0451577_0008114 3300042876 Bacteria 10247
65 Ga0451577_0023527 3300042876 Bacteria 5616
66 Ga0451577_0071171 3300042876 Bacteria 3101
67 Ga0451577_0090459 3300042876 Bacteria 2732
68 Ga0453683_0008465 3300044673 Bacteria 6901
69 Ga0453683_0023246 3300044673 Bacteria 3951
70 Ga0453683_0026758 3300044673 Bacteria 3662
71 Ga0453683_0028814 3300044673 Bacteria 3513
72 Ga0453683_0156858 3300044673 Unclassified 1439
73 Ga0453684_0000012 3300044712 Bacteria 1062512
74 Ga0453684_0000023 3300044712 Bacteria 857153
75 Ga0453684_0000269 3300044712 Bacteria 223826
76 Ga0453684_0007086 3300044712 Bacteria 20919
77 Ga0453684_0015401 3300044712 Bacteria 12106
78 Ga0453684_0015685 3300044712 Bacteria 11944
79 Ga0453684_0016229 3300044712 Bacteria 11667
80 Ga0453684_0047249 3300044712 Bacteria 5711
81 Ga0453684_0056603 3300044712 Bacteria 5085
82 Ga0453684_0084315 3300044712 Bacteria 3952
83 Ga0453684_0087072 3300044712 Unclassified 3872
84 Ga0453684_0098461 3300044712 Bacteria 3585
85 Ga0453684_0125144 3300044712 Bacteria 3095
86 Ga0453684_0126940 3300044712 Bacteria 3068
87 Ga0453684_0153971 3300044712 Unclassified 2728
88 Ga0453684_0287588 3300044712 Bacteria 1873
89 Ga0453684_0339627 3300044712 Unclassified 1696
90 Ga0453684_0425160 3300044712 Bacteria 1483
91 Ga0453684_0430942 3300044712 Unclassified 1471
92 Ga0451576_0002513 3300045051 Bacteria 27198
93 Ga0451576_0039594 3300045051 Unclassified 4989
94 Ga0451576_0223813 3300045051 Bacteria 1965
95 Ga0451576_0366001 3300045051 Unclassified 1510
96 Ga0451576_0771937 3300045051 Bacteria 1009
97 Ga0501298_020816 3300049521 Bacteria 1225
98 Ga0501040_0075396 3300049576 Bacteria 2331
99 Ga0501041_0127541 3300049577 Bacteria 1584
100 Ga0501048_0054649 3300049582 Bacteria 2837
101 Ga0501048_0478971 3300049582 Bacteria 892
102 Ga0501071_0038230 3300049587 Bacteria 3429
103 Ga0501072_0078680 3300049588 Bacteria 2611
104 Ga0501072_0107808 3300049588 Bacteria 2216
105 Ga0501072_0710096 3300049588 Bacteria 790
106 Ga0501075_0031323 3300049591 Bacteria 3946
107 Ga0501075_0069321 3300049591 Bacteria 2665
108 Ga0501075_0183378 3300049591 Bacteria 1597
109 Ga0501075_0284845 3300049591 Unclassified 1259
110 Ga0501076_0024515 3300049592 Bacteria 4663
111 Ga0501076_0132464 3300049592 Unclassified 2022
112 Ga0501076_0245620 3300049592 Bacteria 1464
113 Ga0501079_0013340 3300049741 Bacteria 6267
114 Ga0501079_0057324 3300049741 Bacteria 3006
115 Ga0501081_0048714 3300049743 Bacteria 2916
116 Ga0501081_0110998 3300049743 Bacteria 1946
117 Ga0501045_0324535 3300049824 Bacteria 1146
118 nmdc:mga05p37_17310_c1 3300050507 Bacteria 8695
119 nmdc:mga05p37_21134_c1 3300050507 Bacteria 7879
120 nmdc:mga09592_497_c1 3300050508 Bacteria 29593
121 nmdc:mga0qj67_155565_c1 3300050509 Unclassified 1855
122 nmdc:mga0n895_214983_c1 3300050512 Viruses 1952
123 nmdc:mga0a205_27900_c1 3300050515 Bacteria 5394
124 Ga0501084_0032786 3300054114 Bacteria 4347
125 Ga0530510_0140187 3300061734 Bacteria 1781
126 Ga0501036_0191441
127 JGI25406J46586_10000277
128 Ga0065707_10010991
129 Ga0065707_10083939
130 Ga0065707_10088537
131 Ga0065707_10107260
132 Ga0070689_100079468
133 Ga0070706_100010578
134 Ga0070707_100172136
135 Ga0070707_100221383
136 Ga0070698_100031801
137 Ga0070698_100390016
138 Ga0070698_100392047
139 Ga0070699_100001435
140 Ga0070699_100004257
141 Ga0070699_100115201
142 Ga0070695_100062570
143 Ga0070695_100317322
144 Ga0070704_100045663
145 Ga0068857_100335447
146 Ga0068862_100153865
147 Ga0081539_10000947
148 Ga0075428_100076202
149 Ga0075430_100337520
150 Ga0075433_10024294
151 Ga0075429_100004697
152 Ga0075429_100030252
153 Ga0075429_100046830
154 Ga0075429_100395205
155 Ga0111539_10203144
156 Ga0114129_10002393
157 Ga0114129_10181462
158 Ga0114129_10368099
159 Ga0114129_10483641
160 Ga0114129_11574438
161 Ga0105243_10165745
162 Ga0105242_10368400
163 Ga0105246_10040408
164 Ga0207684_10088086
165 Ga0207708_10045837
166 Ga0207676_10289923
167 Ga0207674_10263591
168 Ga0268265_10125273
169 Ga0268265_10145968
170 Ga0265318_10005949
171 Ga0265338_10071574
172 Ga0265328_10049040
173 Ga0265320_10021278
174 Ga0265340_10013170
175 Ga0265340_10054422
176 Ga0265331_10004401
177 Ga0265316_10161750
178 Ga0316579_10026628
179 Ga0265342_10080498
180 Ga0307405_10092570
181 Ga0307413_10218116
182 Ga0307407_10104762
183 Ga0307412_10056670
184 Ga0307416_100283014
185 Ga0307416_100639375
186 Ga0316584_0180403
187 Ga0316581_0009945
188 Ga0451577_0003280
189 Ga0451577_0008114
190 Ga0451577_0023527
191 Ga0451577_0071171
192 Ga0451577_0090459
193 Ga0453683_0008465
194 Ga0453683_0023246
195 Ga0453683_0026758
196 Ga0453683_0028814
197 Ga0453683_0156858
198 Ga0453684_0000012
199 Ga0453684_0000023
200 Ga0453684_0000269
201 Ga0453684_0007086
202 Ga0453684_0015401
203 Ga0453684_0015685
204 Ga0453684_0016229
205 Ga0453684_0047249
206 Ga0453684_0056603
207 Ga0453684_0084315
208 Ga0453684_0087072
209 Ga0453684_0098461
210 Ga0453684_0125144
211 Ga0453684_0126940
212 Ga0453684_0153971
213 Ga0453684_0287588
214 Ga0453684_0339627
215 Ga0453684_0425160
216 Ga0453684_0430942
217 Ga0451576_0002513
218 Ga0451576_0039594
219 Ga0451576_0223813
220 Ga0451576_0366001
221 Ga0451576_0771937
222 Ga0501298_020816
223 Ga0501040_0075396
224 Ga0501041_0127541
225 Ga0501048_0054649
226 Ga0501048_0478971
227 Ga0501071_0038230
228 Ga0501072_0078680
229 Ga0501072_0107808
230 Ga0501072_0710096
231 Ga0501075_0031323
232 Ga0501075_0069321
233 Ga0501075_0183378
234 Ga0501075_0284845
235 Ga0501076_0024515
236 Ga0501076_0132464
237 Ga0501076_0245620
238 Ga0501079_0013340
239 Ga0501079_0057324
240 Ga0501081_0048714
241 Ga0501081_0110998
242 Ga0501045_0324535
243 nmdc:mga05p37_17310_c1
244 nmdc:mga05p37_21134_c1
245 nmdc:mga09592_497_c1
246 nmdc:mga0qj67_155565_c1
247 nmdc:mga0n895_214983_c1
248 nmdc:mga0a205_27900_c1
249 Ga0501084_0032786
250 Ga0530510_0140187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

134

281

0.92

PF13462

Thioredoxin_4

Thioredoxin

120

282

0.89

PF13098

Thioredoxin_2

Thioredoxin-like domain

128

280

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7unn-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda from corynebacterium diphtheriae 0.9129 92 251
7uno-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda, c129s mutant, from corynebacterium diphtheriae 0.9122 92 251
4pwp-assembly1.cif.gz_A crystal structure of dsba from the gram positive bacterium corynebacterium diphtheriae 0.912 92 251
4pwo-assembly1.cif.gz_A crystal structure of dsba from the gram positive bacterium corynebacterium diphtheriae 0.9029 92 251
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.8978 90 249
ID Description Score Start End Superfamily
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8679 78 252 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8632 90 253 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8605 100 249 3.40.30.10
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8248 93 256 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8205 78 252 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3L7Y0Q0-F1-model_v4 DsbA family protein 0.989 81 253
AF-A0A3M2DJF5-F1-model_v4 Thioredoxin 0.9821 92 253
AF-A0A7V1GT85-F1-model_v4 Thioredoxin domain-containing protein 0.9791 81 252
AF-A0A3D0IBS5-F1-model_v4 Thioredoxin 0.9777 79 253
AF-A0A3N5ZNT3-F1-model_v4 DsbA family protein 0.9765 79 251

Map