F127356

General Info

Members Datasets Scaffolds Average Seq Length
125 92 124 324

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0019954|Ga0373937_0019954_2800_3954
Length 371
Sequence MSEIIDDAVQILRKGGIVAFPTETVYGLGADASSLPAVRRVFTVKGRPATNPVIVHVADITIAKRYAALWPDAAARLTGRFWPGPLTIILPKTDAIVTAATAGRKTVGLRAPDHQLALEVLSAFDGPVIGPSANRTTRVSPTTAQHVRDELGSRIDLVLDGGPCKVGIESTVVDLTTTPPTILRPGAITRFQIEQVIGPVEVFSGSVAGDKSAPGPGMQASHYAPATPTYRFDRKYADRVAAWCVKNPDKAAIILRLGAPTSDDPIPHALSMNQRQIMMPSEAVEYARQMYGTMRHADRQSSAAIWVEMPPDDAHWFAVRDRLMRATRNPPSWPNKSWRLQIPVIRLNCPAGAKLPRGPSLPSRWRCNDSG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
67 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 8.8
Rhizosphere 86.4
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10002311 3300003316 Bacteria 4369
2 rootL2_10002078 3300003322 Bacteria 19707
3 Ga0070683_100248565 3300005329 Bacteria 1691
4 Ga0070671_100020545 3300005355 Bacteria 5386
5 Ga0070673_100120500 3300005364 Bacteria 2188
6 Ga0070714_100043595 3300005435 Bacteria 3795
7 Ga0070714_100152137 3300005435 Bacteria 2086
8 Ga0070713_100246491 3300005436 Bacteria 1628
9 Ga0070706_100000394 3300005467 Bacteria 52537
10 Ga0070707_100191328 3300005468 Bacteria 1995
11 Ga0070698_100032423 3300005471 Bacteria 5412
12 Ga0070698_100051621 3300005471 Bacteria 4188
13 Ga0068853_100105763 3300005539 Bacteria 2493
14 Ga0070672_100108448 3300005543 Bacteria 2260
15 Ga0070686_100116551 3300005544 Bacteria 1828
16 Ga0070665_100000708 3300005548 Bacteria 44356
17 Ga0068855_100413199 3300005563 Unclassified 1477
18 Ga0068854_100076990 3300005578 Bacteria 2453
19 Ga0068856_100126437 3300005614 Bacteria 2560
20 Ga0068862_100457485 3300005844 Bacteria 1204
21 Ga0070717_10136264 3300006028 Bacteria 2114
22 Ga0075368_10053365 3300006042 Bacteria 1609
23 Ga0070716_100204925 3300006173 Bacteria 1314
24 Ga0105240_10133927 3300009093 Bacteria 2969
25 Ga0105245_10192694 3300009098 Bacteria 1953
26 Ga0105245_10620906 3300009098 Bacteria 1109
27 Ga0105243_10311143 3300009148 Bacteria 1431
28 Ga0105239_10159149 3300010375 Bacteria 2522
29 Ga0157370_10107254 3300013104 Bacteria 2613
30 Ga0157370_10353671 3300013104 Bacteria 1354
31 Ga0157369_10040807 3300013105 Bacteria 5067
32 Ga0157369_10099914 3300013105 Bacteria 3093
33 Ga0157369_10237695 3300013105 Bacteria 1903
34 Ga0157372_10015741 3300013307 Bacteria 8110
35 Ga0157372_10023232 3300013307 Bacteria 6719
36 Ga0157372_10043157 3300013307 Bacteria 4991
37 Ga0157379_10051741 3300014968 Bacteria 3668
38 Ga0213872_10026370 3300021361 Bacteria 2669
39 Ga0207684_10000803 3300025910 Bacteria 36344
40 Ga0207695_10000426 3300025913 Bacteria 93260
41 Ga0207659_10097117 3300025926 Bacteria 2212
42 Ga0207664_10048946 3300025929 Unclassified 3326
43 Ga0207664_10385613 3300025929 Bacteria 1244
44 Ga0207644_10026590 3300025931 Bacteria 3989
45 Ga0207691_10053601 3300025940 Bacteria 3682
46 Ga0207661_10087346 3300025944 Bacteria 2590
47 Ga0207651_10234103 3300025960 Bacteria 1493
48 Ga0207639_10084326 3300026041 Bacteria 2524
49 Ga0207702_10153102 3300026078 Bacteria 2099
50 Ga0207675_100448278 3300026118 Bacteria 1278
51 Ga0268266_10001134 3300028379 Bacteria 33194
52 Ga0265334_10000567 3300028573 Bacteria 18795
53 Ga0265318_10000016 3300028577 Bacteria 184782
54 Ga0265320_10000933 3300031240 Bacteria 21786
55 Ga0265320_10003458 3300031240 Bacteria 10595
56 Ga0265331_10016019 3300031250 Bacteria 3943
57 Ga0265331_10041880 3300031250 Unclassified 2223
58 Ga0265327_10039941 3300031251 Bacteria 2543
59 Ga0265316_10094734 3300031344 Bacteria 2275
60 Ga0265313_10001043 3300031595 Bacteria 26985
61 Ga0265314_10002221 3300031711 Bacteria 20208
62 Ga0265314_10004942 3300031711 Bacteria 12171
63 Ga0265314_10005140 3300031711 Bacteria 11898
64 Ga0265314_10028578 3300031711 Bacteria 4156
65 Ga0316576_10030380 3300031727 Bacteria 3826
66 Ga0316576_10036508 3300031727 Bacteria 3514
67 Ga0307410_10061862 3300031852 Bacteria 2563
68 Ga0373953_0028634 3300035117 Bacteria 2150
69 Ga0316574_0056525 3300035398 Bacteria 2455
70 Ga0373937_0019954 3300036401 Bacteria 6003
71 Ga0395905_0309541 3300037471 Bacteria 1468
72 Ga0395901_0067536 3300038443 Bacteria 3723
73 Ga0436361_0456842 3300039447 Bacteria 43282
74 Ga0436361_0728243 3300039447 Bacteria 20207
75 Ga0451577_0004965 3300042876 Bacteria 13821
76 Ga0453683_0014233 3300044673 Bacteria 5171
77 Ga0453684_0004009 3300044712 Bacteria 32092
78 Ga0453684_0178943 3300044712 Bacteria 2491
79 Ga0453684_0282790 3300044712 Bacteria 1891
80 Ga0451576_0000035 3300045051 Bacteria 379076
81 Ga0466958_0058740 3300045836 Bacteria 2339
82 Ga0495630_0036413 3300046517 Bacteria 3678
83 Ga0495630_0063697 3300046517 Bacteria 2770
84 Ga0495630_0089668 3300046517 Bacteria 2323
85 Ga0495658_0024589 3300046683 Bacteria 3210
86 Ga0495672_0115547 3300047320 Bacteria 1434
87 Ga0495684_0068942 3300047471 Bacteria 2689
88 Ga0496100_0047576 3300048903 Bacteria 2765
89 Ga0496101_0289487 3300048904 Bacteria 1281
90 Ga0496104_0076637 3300048907 Bacteria 3185
91 Ga0496105_0028609 3300048908 Bacteria 4558
92 Ga0496109_0074453 3300048912 Bacteria 3121
93 Ga0496109_0267358 3300048912 Archaea 1611
94 Ga0496110_0092408 3300048913 Bacteria 2708
95 Ga0496110_0104182 3300048913 Bacteria 2545
96 Ga0496112_0048826 3300048915 Bacteria 4147
97 Ga0496112_0506770 3300048915 Bacteria 1142
98 Ga0496115_0002370 3300048918 Bacteria 13513
99 Ga0501032_0155399 3300049569 Bacteria 1503
100 Ga0501033_0258128 3300049570 Bacteria 1234
101 Ga0501034_0090184 3300049571 Bacteria 3064
102 Ga0501037_0057464 3300049573 Bacteria 2840
103 Ga0501037_0101457 3300049573 Bacteria 2077
104 Ga0501038_0307761 3300049574 Bacteria 1242
105 Ga0501046_0110988 3300049580 Bacteria 2095
106 Ga0501047_0004372 3300049581 Bacteria 13299
107 Ga0501047_0081373 3300049581 Bacteria 3113
108 Ga0501047_0176193 3300049581 Bacteria 2005
109 Ga0501047_0203656 3300049581 Bacteria 1839
110 Ga0501047_0346039 3300049581 Unclassified 1324
111 Ga0501070_0076176 3300049586 Bacteria 2777
112 Ga0501080_0008707 3300049742 Bacteria 9212
113 Ga0501080_0222259 3300049742 Bacteria 1728
114 Ga0501080_0334526 3300049742 Bacteria 1369
115 Ga0501083_0013599 3300049744 Bacteria 5690
116 Ga0501035_0062407 3300049822 Bacteria 3316
117 Ga0501044_0005646 3300049823 Bacteria 13886
118 Ga0501044_0013727 3300049823 Bacteria 8753
119 Ga0501044_0040958 3300049823 Bacteria 4824
120 Ga0501044_0350281 3300049823 Bacteria 1396
121 nmdc:mga00v17_188866_c1 3300050491 Bacteria 1330
122 nmdc:mga04h51_37468_c1 3300050495 Bacteria 1565
123 Ga0495619_0091983 3300053085 Bacteria 2054
124 Ga0501082_0103202 3300060353 Bacteria 2467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10053365 Ga0075368_100533652 291
2 3300050491 nmdc:mga00v17_188866_c1 nmdc:mga00v17_188866_c1_246_1280 291
3 3300050495 nmdc:mga04h51_37468_c1 nmdc:mga04h51_37468_c1_240_1274 291
4 3300049581 Ga0501047_0203656 Ga0501047_0203656_408_1391 297
5 3300048915 Ga0496112_0506770 Ga0496112_0506770_232_1131 299
6 3300014968 Ga0157379_10051741 Ga0157379_100517413 301
7 3300049569 Ga0501032_0155399 Ga0501032_0155399_493_1407 301
8 3300049570 Ga0501033_0258128 Ga0501033_0258128_87_1001 301
9 3300049573 Ga0501037_0101457 Ga0501037_0101457_681_1595 301
10 3300049574 Ga0501038_0307761 Ga0501038_0307761_63_977 301
11 3300049580 Ga0501046_0110988 Ga0501046_0110988_900_1814 301
12 3300049581 Ga0501047_0004372 Ga0501047_0004372_7406_8320 301
13 3300049586 Ga0501070_0076176 Ga0501070_0076176_145_1059 301
14 3300049742 Ga0501080_0222259 Ga0501080_0222259_111_1025 301
15 3300049742 Ga0501080_0334526 Ga0501080_0334526_11_976 301
16 3300049822 Ga0501035_0062407 Ga0501035_0062407_464_1378 301
17 3300049823 Ga0501044_0005646 Ga0501044_0005646_10430_11344 301
18 3300005548 Ga0070665_100000708 Ga0070665_10000070829 302
19 3300013104 Ga0157370_10353671 Ga0157370_103536712 302
20 3300028379 Ga0268266_10001134 Ga0268266_100011347 302
21 3300048912 Ga0496109_0074453 Ga0496109_0074453_1426_2340 302
22 3300048913 Ga0496110_0104182 Ga0496110_0104182_186_1100 302
23 3300048915 Ga0496112_0048826 Ga0496112_0048826_186_1100 302
24 3300044712 Ga0453684_0282790 Ga0453684_0282790_219_1184 303
25 3300046683 Ga0495658_0024589 Ga0495658_0024589_1475_2473 303
26 3300013307 Ga0157372_10023232 Ga0157372_100232322 308
27 3300031250 Ga0265331_10041880 Ga0265331_100418801 308
28 3300049823 Ga0501044_0350281 Ga0501044_0350281_36_986 308
29 3300013307 Ga0157372_10043157 Ga0157372_100431576 309
30 3300031240 Ga0265320_10000933 Ga0265320_100009335 309
31 3300031711 Ga0265314_10028578 Ga0265314_100285785 309
32 3300039447 Ga0436361_0456842 Ga0436361_0456842_39809_40798 310
33 3300046517 Ga0495630_0036413 Ga0495630_0036413_462_1460 310
34 3300047471 Ga0495684_0068942 Ga0495684_0068942_917_1915 310
35 3300005471 Ga0070698_100051621 Ga0070698_1000516211 312
36 3300005539 Ga0068853_100105763 Ga0068853_1001057632 312
37 3300009098 Ga0105245_10192694 Ga0105245_101926941 312
38 3300026041 Ga0207639_10084326 Ga0207639_100843262 312
39 3300031251 Ga0265327_10039941 Ga0265327_100399412 312
40 3300031344 Ga0265316_10094734 Ga0265316_100947343 312
41 3300005544 Ga0070686_100116551 Ga0070686_1001165512 313
42 3300005844 Ga0068862_100457485 Ga0068862_1004574852 313
43 3300009098 Ga0105245_10620906 Ga0105245_106209061 313
44 3300026118 Ga0207675_100448278 Ga0207675_1004482781 313
45 3300031711 Ga0265314_10004942 Ga0265314_100049428 315
46 3300031727 Ga0316576_10030380 Ga0316576_100303803 316
47 3300044712 Ga0453684_0004009 Ga0453684_0004009_1018_2022 316
48 3300045051 Ga0451576_0000035 Ga0451576_0000035_236644_237648 316
49 3300006028 Ga0070717_10136264 Ga0070717_101362642 317
50 3300006173 Ga0070716_100204925 Ga0070716_1002049252 317
51 3300046517 Ga0495630_0089668 Ga0495630_0089668_391_1344 317
52 3300048903 Ga0496100_0047576 Ga0496100_0047576_586_1539 317
53 3300048904 Ga0496101_0289487 Ga0496101_0289487_82_1035 317
54 3300048907 Ga0496104_0076637 Ga0496104_0076637_37_990 317
55 3300048918 Ga0496115_0002370 Ga0496115_0002370_1186_2139 317
56 3300031727 Ga0316576_10036508 Ga0316576_100365082 318
57 3300031852 Ga0307410_10061862 Ga0307410_100618624 318
58 3300035398 Ga0316574_0056525 Ga0316574_0056525_710_1738 318
59 3300038443 Ga0395901_0067536 Ga0395901_0067536_625_1587 318
60 3300044673 Ga0453683_0014233 Ga0453683_0014233_992_1978 318
61 3300005329 Ga0070683_100248565 Ga0070683_1002485652 319
62 3300005543 Ga0070672_100108448 Ga0070672_1001084483 319
63 3300005563 Ga0068855_100413199 Ga0068855_1004131993 319
64 3300005614 Ga0068856_100126437 Ga0068856_1001264373 319
65 3300009093 Ga0105240_10133927 Ga0105240_101339272 319
66 3300009148 Ga0105243_10311143 Ga0105243_103111432 319
67 3300013104 Ga0157370_10107254 Ga0157370_101072543 319
68 3300013105 Ga0157369_10237695 Ga0157369_102376952 319
69 3300025913 Ga0207695_10000426 Ga0207695_1000042676 319
70 3300025940 Ga0207691_10053601 Ga0207691_100536012 319
71 3300025944 Ga0207661_10087346 Ga0207661_100873462 319
72 3300026078 Ga0207702_10153102 Ga0207702_101531022 319
73 3300048912 Ga0496109_0267358 Ga0496109_0267358_263_1246 319
74 3300048913 Ga0496110_0092408 Ga0496110_0092408_1012_1992 319
75 3300053085 Ga0495619_0091983 Ga0495619_0091983_893_1933 319
76 3300005435 Ga0070714_100152137 Ga0070714_1001521371 320
77 3300010375 Ga0105239_10159149 Ga0105239_101591492 320
78 3300013105 Ga0157369_10099914 Ga0157369_100999143 320
79 3300013307 Ga0157372_10015741 Ga0157372_100157416 320
80 3300028573 Ga0265334_10000567 Ga0265334_1000056718 320
81 3300028577 Ga0265318_10000016 Ga0265318_10000016121 320
82 3300031240 Ga0265320_10003458 Ga0265320_1000345814 320
83 3300031250 Ga0265331_10016019 Ga0265331_100160194 320
84 3300031595 Ga0265313_10001043 Ga0265313_1000104332 320
85 3300031711 Ga0265314_10005140 Ga0265314_1000514011 320
86 3300005355 Ga0070671_100020545 Ga0070671_1000205454 321
87 3300005435 Ga0070714_100043595 Ga0070714_1000435952 321
88 3300025929 Ga0207664_10385613 Ga0207664_103856131 321
89 3300025931 Ga0207644_10026590 Ga0207644_100265904 321
90 3300037471 Ga0395905_0309541 Ga0395905_0309541_377_1366 322
91 3300044712 Ga0453684_0178943 Ga0453684_0178943_39_1010 322
92 3300045836 Ga0466958_0058740 Ga0466958_0058740_104_1093 322
93 3300046517 Ga0495630_0063697 Ga0495630_0063697_1113_2084 322
94 3300049581 Ga0501047_0176193 Ga0501047_0176193_434_1429 322
95 3300005436 Ga0070713_100246491 Ga0070713_1002464913 323
96 3300025929 Ga0207664_10048946 Ga0207664_100489461 323
97 3300036401 Ga0373937_0019954 Ga0373937_0019954_2800_3954 323
98 3300048908 Ga0496105_0028609 Ga0496105_0028609_160_1155 323
99 3300049581 Ga0501047_0346039 Ga0501047_0346039_265_1266 323
100 3300049744 Ga0501083_0013599 Ga0501083_0013599_485_1486 323
101 3300049823 Ga0501044_0040958 Ga0501044_0040958_45_1046 323
102 3300031711 Ga0265314_10002221 Ga0265314_1000222114 324
103 3300042876 Ga0451577_0004965 Ga0451577_0004965_3864_4859 324
104 3300049573 Ga0501037_0057464 Ga0501037_0057464_435_1436 324
105 3300049742 Ga0501080_0008707 Ga0501080_0008707_4634_5635 324
106 3300049823 Ga0501044_0013727 Ga0501044_0013727_4974_5975 324
107 3300060353 Ga0501082_0103202 Ga0501082_0103202_765_1766 324
108 3300005578 Ga0068854_100076990 Ga0068854_1000769902 325
109 3300013105 Ga0157369_10040807 Ga0157369_100408075 325
110 3300003316 rootH1_10002311 rootH1_100023113 326
111 3300003322 rootL2_10002078 rootL2_100020788 326
112 3300005364 Ga0070673_100120500 Ga0070673_1001205002 326
113 3300005467 Ga0070706_100000394 Ga0070706_10000039424 326
114 3300005468 Ga0070707_100191328 Ga0070707_1001913281 326
115 3300005471 Ga0070698_100032423 Ga0070698_1000324233 326
116 3300021361 Ga0213872_10026370 Ga0213872_100263702 326
117 3300025910 Ga0207684_10000803 Ga0207684_1000080324 326
118 3300025926 Ga0207659_10097117 Ga0207659_100971172 326
119 3300025960 Ga0207651_10234103 Ga0207651_102341032 326
120 3300035117 Ga0373953_0028634 Ga0373953_0028634_827_1873 326
121 3300039447 Ga0436361_0728243 Ga0436361_0728243_16966_17949 326
122 3300047320 Ga0495672_0115547 Ga0495672_0115547_389_1387 326
123 3300049571 Ga0501034_0090184 Ga0501034_0090184_944_1939 326
124 3300049581 Ga0501047_0081373 Ga0501047_0081373_1933_2928 326
125 iso_pu_bacteria 8001522603 8001524874 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

10

186

0.98

PF03481

Sua5_C

Threonylcarbamoyl-AMP synthase, C-terminal domain

188

327

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.9236 8 326
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.9018 8 326
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.8972 8 320
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.8958 8 323
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8953 1 323
ID Description Score Start End Superfamily
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9725 8 205 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9626 8 203 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9619 8 205 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9565 8 196 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9547 8 201 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A7K0X6E7-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9973 8 153 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A3B9PK50-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9946 8 181 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q3JEQ4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9927 8 118 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A6B3CB38-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9881 7 124 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A7C5X9Y3-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9871 8 146 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Feature Viewer

pLDDT pTM Quality
92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map