F124633

General Info

Members Datasets Scaffolds Average Seq Length
125 100 123 186

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10077981|JGI24740J21852_100779811
Length 213
Sequence MRFDMRKRPQIEMSPISDLNIQIAKNMKTYLLPAIKLTMVLIILLAAIYPLAIAGVGKLTPGQGDGETIKYKGRVVGYANIGQKFTRDKYFWSRPSAVDYNAAGSGGSNKGPSNPDYLKDVQSRIDTFMKHNPGVKKSDIPAELITASGSGLDPDLSPAGAKVQVARIAKVRGVSINVVNHIIAKNTERPLWGMFGPAKVNVLKLNIALDELK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
95 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
96 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
99 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
100 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0
Rhizoplane 0
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8678384 2162886011 Unclassified 933
2 JGI24740J21852_10077981 3300001979 Bacteria 873
3 JGI24739J22299_10000185 3300001989 Bacteria 20683
4 JGI25153J46596_10034290 3300003215 Bacteria 1662
5 rootH1_10062810 3300003316 Bacteria 1678
6 rootH2_10020840 3300003320 Bacteria 1970
7 rootH2_10143410 3300003320 Bacteria 3431
8 rootH1_10059845 3300003323 Bacteria 2065
9 Ga0055526_1008481 3300003771 Bacteria 5123
10 Ga0065714_10095568 3300005288 Bacteria 1783
11 Ga0065714_10098737 3300005288 Bacteria 1703
12 Ga0065712_10097918 3300005290 Bacteria 2114
13 Ga0065712_10427368 3300005290 Unclassified 706
14 Ga0070683_100106319 3300005329 Bacteria 2646
15 Ga0070670_100062216 3300005331 Bacteria 3205
16 Ga0070680_100011465 3300005336 Bacteria 6858
17 Ga0070660_100326147 3300005339 Bacteria 1262
18 Ga0070660_100775162 3300005339 Bacteria 806
19 Ga0070691_10001918 3300005341 Bacteria 9126
20 Ga0070661_100291490 3300005344 Bacteria 1268
21 Ga0070673_100238847 3300005364 Bacteria 1579
22 Ga0070667_100588888 3300005367 Bacteria 1024
23 Ga0068867_100857151 3300005459 Bacteria 814
24 Ga0070679_100029839 3300005530 Bacteria 5381
25 Ga0068853_100028163 3300005539 Bacteria 4724
26 Ga0068853_100182386 3300005539 Bacteria 1904
27 Ga0068853_100582847 3300005539 Bacteria 1061
28 Ga0070672_100070688 3300005543 Bacteria 2774
29 Ga0070693_100001528 3300005547 Bacteria 10447
30 Ga0070665_100005210 3300005548 Bacteria 13452
31 Ga0068855_100002947 3300005563 Bacteria 20801
32 Ga0070664_100393756 3300005564 Bacteria 1266
33 Ga0068857_100042811 3300005577 Bacteria 4018
34 Ga0068854_100032904 3300005578 Bacteria 3611
35 Ga0068851_10056562 3300005834 Bacteria 2001
36 Ga0081539_10006106 3300005985 Bacteria 11752
37 Ga0105240_10011376 3300009093 Bacteria 12396
38 Ga0105240_10018321 3300009093 Bacteria 9410
39 Ga0105240_10063724 3300009093 Bacteria 4583
40 Ga0111539_10145858 3300009094 Bacteria 2771
41 Ga0105241_10005808 3300009174 Bacteria 9113
42 Ga0105241_10579310 3300009174 Bacteria 1011
43 Ga0105237_10015968 3300009545 Bacteria 7807
44 Ga0105237_10455190 3300009545 Bacteria 1286
45 Ga0105237_10458139 3300009545 Bacteria 1281
46 Ga0105239_10331121 3300010375 Bacteria 1718
47 Ga0105239_11707314 3300010375 Bacteria 729
48 Ga0157371_10054804 3300013102 Bacteria 2830
49 Ga0157371_10288934 3300013102 Bacteria 1185
50 Ga0157370_10016249 3300013104 Bacteria 7541
51 Ga0157369_10000533 3300013105 Bacteria 50305
52 Ga0157369_10155922 3300013105 Bacteria 2412
53 Ga0157369_10716512 3300013105 Unclassified 1030
54 Ga0157374_10057759 3300013296 Bacteria 3625
55 Ga0157372_10572148 3300013307 Bacteria 1317
56 Ga0157372_10582827 3300013307 Bacteria 1304
57 Ga0157380_10066887 3300014326 Bacteria 2892
58 Ga0182008_10000028 3300014497 Bacteria 176968
59 Ga0209564_1005139 3300025295 Bacteria 7602
60 Ga0209758_1010788 3300025297 Bacteria 5409
61 Ga0207426_1013682 3300025302 Bacteria 2996
62 Ga0207656_10000126 3300025321 Bacteria 29065
63 Ga0207680_10120847 3300025903 Bacteria 1713
64 Ga0207680_10268387 3300025903 Bacteria 1183
65 Ga0207647_10002359 3300025904 Bacteria 14347
66 Ga0207654_10001910 3300025911 Bacteria 10811
67 Ga0207707_10001079 3300025912 Bacteria 26123
68 Ga0207695_10015285 3300025913 Bacteria 9046
69 Ga0207695_10026464 3300025913 Bacteria 6475
70 Ga0207671_10071435 3300025914 Bacteria 2589
71 Ga0207671_10459018 3300025914 Unclassified 1015
72 Ga0207660_10007718 3300025917 Bacteria 6964
73 Ga0207657_10336781 3300025919 Bacteria 1191
74 Ga0207657_10339103 3300025919 Bacteria 1186
75 Ga0207649_10697704 3300025920 Bacteria 787
76 Ga0207652_10008225 3300025921 Bacteria 8378
77 Ga0207681_10509035 3300025923 Bacteria 987
78 Ga0207650_10593522 3300025925 Bacteria 931
79 Ga0207659_10031118 3300025926 Bacteria 3651
80 Ga0207690_10107575 3300025932 Bacteria 2003
81 Ga0207691_10347237 3300025940 Bacteria 1270
82 Ga0207661_10273156 3300025944 Bacteria 1509
83 Ga0207679_10177417 3300025945 Bacteria 1759
84 Ga0207679_10337676 3300025945 Bacteria 1309
85 Ga0207667_10003048 3300025949 Bacteria 20784
86 Ga0207667_10417827 3300025949 Bacteria 1365
87 Ga0207640_10043995 3300025981 Bacteria 2858
88 Ga0207677_10872694 3300026023 Bacteria 810
89 Ga0207639_10037188 3300026041 Bacteria 3614
90 Ga0207639_10045926 3300026041 Bacteria 3293
91 Ga0207702_10084546 3300026078 Bacteria 2763
92 Ga0207648_10509426 3300026089 Bacteria 1102
93 Ga0207674_10420683 3300026116 Bacteria 1291
94 Ga0207428_10071163 3300027907 Bacteria 2732
95 Ga0268266_10004417 3300028379 Bacteria 13474
96 Ga0307515_10523553 3300028794 Bacteria 795
97 Ga0265327_10077326 3300031251 Bacteria 1651
98 Ga0307513_10154847 3300031456 Bacteria 2194
99 Ga0265314_10173036 3300031711 Unclassified 1301
100 Ga0307413_10083149 3300031824 Bacteria 2059
101 Ga0307414_10014982 3300032004 Bacteria 4668
102 Ga0307510_10125365 3300033180 Bacteria 2259
103 Ga0395900_0732407 3300037418 Bacteria 920
104 Ga0395905_0095197 3300037471 Bacteria 2795
105 Ga0395905_0228114 3300037471 Bacteria 1742
106 Ga0395901_0020553 3300038443 Bacteria 6757
107 Ga0451577_0102312 3300042876 Bacteria 2560
108 Ga0466968_0113724 3300044735 Bacteria 1219
109 Ga0466960_0063454 3300044901 Bacteria 1819
110 Ga0495650_0138393 3300046471 Bacteria 882
111 Ga0495664_0283918 3300046477 Bacteria 1000
112 Ga0495663_0000039 3300046525 Bacteria 68141
113 Ga0495609_0074438 3300046538 Bacteria 1489
114 Ga0495672_0046261 3300047320 Bacteria 2596
115 Ga0495672_0250034 3300047320 Bacteria 861
116 Ga0501047_0909424 3300049581 Bacteria 693
117 Ga0501249_000006 3300049679 Bacteria 224148
118 Ga0501251_014306 3300049681 Bacteria 984
119 Ga0501241_010824 3300049758 Bacteria 1656
120 nmdc:mga08y16_117165_c1 3300050511 Bacteria 2773
121 Ga0500646_0076924 3300053090 Bacteria 1011
122 Ga0500641_0000280 3300053096 Bacteria 19019
123 Ga0500594_0019839 3300053118 Bacteria 1670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10095568 Ga0065714_100955681 162
2 3300037471 Ga0395905_0095197 Ga0395905_0095197_2110_2664 162
3 3300053096 Ga0500641_0000280 Ga0500641_0000280_15335_15823 162
4 3300053118 Ga0500594_0019839 Ga0500594_0019839_670_1158 162
5 3300003320 rootH2_10020840 rootH2_100208402 163
6 3300049581 Ga0501047_0909424 Ga0501047_0909424_76_639 164
7 3300005290 Ga0065712_10097918 Ga0065712_100979182 169
8 3300005331 Ga0070670_100062216 Ga0070670_1000622162 169
9 3300005367 Ga0070667_100588888 Ga0070667_1005888882 169
10 3300005543 Ga0070672_100070688 Ga0070672_1000706883 169
11 3300009094 Ga0111539_10145858 Ga0111539_101458582 169
12 3300025923 Ga0207681_10509035 Ga0207681_105090352 169
13 3300025926 Ga0207659_10031118 Ga0207659_100311182 169
14 3300025940 Ga0207691_10347237 Ga0207691_103472372 169
15 3300027907 Ga0207428_10071163 Ga0207428_100711632 169
16 3300050511 nmdc:mga08y16_117165_c1 nmdc:mga08y16_117165_c1_1887_2447 169
17 3300001989 JGI24739J22299_10000185 JGI24739J22299_100001859 171
18 3300003215 JGI25153J46596_10034290 JGI25153J46596_100342902 171
19 3300003771 Ga0055526_1008481 Ga0055526_10084813 171
20 3300005548 Ga0070665_100005210 Ga0070665_1000052109 171
21 3300005578 Ga0068854_100032904 Ga0068854_1000329042 171
22 3300009093 Ga0105240_10018321 Ga0105240_100183219 171
23 3300009093 Ga0105240_10063724 Ga0105240_100637243 171
24 3300013102 Ga0157371_10288934 Ga0157371_102889342 171
25 3300014497 Ga0182008_10000028 Ga0182008_1000002877 171
26 3300025295 Ga0209564_1005139 Ga0209564_10051395 171
27 3300025297 Ga0209758_1010788 Ga0209758_10107883 171
28 3300025302 Ga0207426_1013682 Ga0207426_10136823 171
29 3300025321 Ga0207656_10000126 Ga0207656_1000012615 171
30 3300025904 Ga0207647_10002359 Ga0207647_100023596 171
31 3300025913 Ga0207695_10026464 Ga0207695_100264643 171
32 3300025981 Ga0207640_10043995 Ga0207640_100439952 171
33 3300028379 Ga0268266_10004417 Ga0268266_100044172 171
34 3300028794 Ga0307515_10523553 Ga0307515_105235531 171
35 3300031711 Ga0265314_10173036 Ga0265314_101730362 171
36 3300031824 Ga0307413_10083149 Ga0307413_100831492 171
37 3300032004 Ga0307414_10014982 Ga0307414_100149822 171
38 3300033180 Ga0307510_10125365 Ga0307510_101253652 171
39 3300042876 Ga0451577_0102312 Ga0451577_0102312_74_634 171
40 3300046525 Ga0495663_0000039 Ga0495663_0000039_28506_29072 171
41 3300049679 Ga0501249_000006 Ga0501249_000006_120333_120893 171
42 iso_pu_bacteria 2513020052 2513233204 171
43 2162886011 MRS1b_contig_8678384 MRS1b_0062.00002600 172
44 3300001979 JGI24740J21852_10077981 JGI24740J21852_100779811 172
45 3300003316 rootH1_10062810 rootH1_100628103 172
46 3300003320 rootH2_10143410 rootH2_101434103 172
47 3300003323 rootH1_10059845 rootH1_100598452 172
48 3300005288 Ga0065714_10098737 Ga0065714_100987371 172
49 3300005290 Ga0065712_10427368 Ga0065712_104273681 172
50 3300005329 Ga0070683_100106319 Ga0070683_1001063192 172
51 3300005336 Ga0070680_100011465 Ga0070680_1000114655 172
52 3300005339 Ga0070660_100326147 Ga0070660_1003261472 172
53 3300005339 Ga0070660_100775162 Ga0070660_1007751622 172
54 3300005341 Ga0070691_10001918 Ga0070691_100019185 172
55 3300005344 Ga0070661_100291490 Ga0070661_1002914902 172
56 3300005364 Ga0070673_100238847 Ga0070673_1002388474 172
57 3300005459 Ga0068867_100857151 Ga0068867_1008571511 172
58 3300005530 Ga0070679_100029839 Ga0070679_1000298393 172
59 3300005539 Ga0068853_100028163 Ga0068853_1000281633 172
60 3300005539 Ga0068853_100182386 Ga0068853_1001823861 172
61 3300005539 Ga0068853_100582847 Ga0068853_1005828472 172
62 3300005547 Ga0070693_100001528 Ga0070693_1000015283 172
63 3300005563 Ga0068855_100002947 Ga0068855_1000029472 172
64 3300005564 Ga0070664_100393756 Ga0070664_1003937562 172
65 3300005577 Ga0068857_100042811 Ga0068857_1000428112 172
66 3300005834 Ga0068851_10056562 Ga0068851_100565622 172
67 3300005985 Ga0081539_10006106 Ga0081539_100061068 172
68 3300009093 Ga0105240_10011376 Ga0105240_100113765 172
69 3300009174 Ga0105241_10005808 Ga0105241_100058084 172
70 3300009174 Ga0105241_10579310 Ga0105241_105793102 172
71 3300009545 Ga0105237_10015968 Ga0105237_100159686 172
72 3300009545 Ga0105237_10455190 Ga0105237_104551902 172
73 3300009545 Ga0105237_10458139 Ga0105237_104581392 172
74 3300010375 Ga0105239_10331121 Ga0105239_103311211 172
75 3300010375 Ga0105239_11707314 Ga0105239_117073142 172
76 3300013102 Ga0157371_10054804 Ga0157371_100548042 172
77 3300013104 Ga0157370_10016249 Ga0157370_100162495 172
78 3300013105 Ga0157369_10000533 Ga0157369_100005332 172
79 3300013105 Ga0157369_10155922 Ga0157369_101559222 172
80 3300013105 Ga0157369_10716512 Ga0157369_107165122 172
81 3300013296 Ga0157374_10057759 Ga0157374_100577592 172
82 3300013307 Ga0157372_10572148 Ga0157372_105721482 172
83 3300013307 Ga0157372_10582827 Ga0157372_105828272 172
84 3300014326 Ga0157380_10066887 Ga0157380_100668873 172
85 3300025903 Ga0207680_10120847 Ga0207680_101208474 172
86 3300025903 Ga0207680_10268387 Ga0207680_102683872 172
87 3300025911 Ga0207654_10001910 Ga0207654_100019106 172
88 3300025912 Ga0207707_10001079 Ga0207707_1000107918 172
89 3300025913 Ga0207695_10015285 Ga0207695_100152855 172
90 3300025914 Ga0207671_10071435 Ga0207671_100714353 172
91 3300025914 Ga0207671_10459018 Ga0207671_104590181 172
92 3300025917 Ga0207660_10007718 Ga0207660_100077185 172
93 3300025919 Ga0207657_10336781 Ga0207657_103367812 172
94 3300025919 Ga0207657_10339103 Ga0207657_103391032 172
95 3300025920 Ga0207649_10697704 Ga0207649_106977041 172
96 3300025921 Ga0207652_10008225 Ga0207652_100082255 172
97 3300025925 Ga0207650_10593522 Ga0207650_105935222 172
98 3300025932 Ga0207690_10107575 Ga0207690_101075752 172
99 3300025944 Ga0207661_10273156 Ga0207661_102731564 172
100 3300025945 Ga0207679_10177417 Ga0207679_101774171 172
101 3300025945 Ga0207679_10337676 Ga0207679_103376762 172
102 3300025949 Ga0207667_10003048 Ga0207667_100030482 172
103 3300025949 Ga0207667_10417827 Ga0207667_104178272 172
104 3300026023 Ga0207677_10872694 Ga0207677_108726941 172
105 3300026041 Ga0207639_10037188 Ga0207639_100371883 172
106 3300026041 Ga0207639_10045926 Ga0207639_100459262 172
107 3300026078 Ga0207702_10084546 Ga0207702_100845462 172
108 3300026089 Ga0207648_10509426 Ga0207648_105094262 172
109 3300026116 Ga0207674_10420683 Ga0207674_104206832 172
110 3300031251 Ga0265327_10077326 Ga0265327_100773262 172
111 3300031456 Ga0307513_10154847 Ga0307513_101548472 172
112 3300037418 Ga0395900_0732407 Ga0395900_0732407_146_709 172
113 3300037471 Ga0395905_0228114 Ga0395905_0228114_1152_1715 172
114 3300038443 Ga0395901_0020553 Ga0395901_0020553_2217_2780 172
115 3300044735 Ga0466968_0113724 Ga0466968_0113724_11_535 172
116 3300044901 Ga0466960_0063454 Ga0466960_0063454_576_1139 172
117 3300046471 Ga0495650_0138393 Ga0495650_0138393_220_783 172
118 3300046477 Ga0495664_0283918 Ga0495664_0283918_233_799 172
119 3300046538 Ga0495609_0074438 Ga0495609_0074438_632_1150 172
120 3300047320 Ga0495672_0046261 Ga0495672_0046261_494_1057 172
121 3300047320 Ga0495672_0250034 Ga0495672_0250034_123_686 172
122 3300049681 Ga0501251_014306 Ga0501251_014306_99_662 172
123 3300049758 Ga0501241_010824 Ga0501241_010824_684_1247 172
124 3300053090 Ga0500646_0076924 Ga0500646_0076924_150_713 172
125 iso_pu_bacteria 2884791551 2884796908 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

31

211

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8575 6 170
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8537 2 170
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8362 2 170
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8211 6 170
6t1t-assembly1.cif.gz_A cytochrome p450 reductase in complex with nadph from candida tropicalis 0.6754 118 144
ID Description Score Start End Superfamily
af_A0A1D8PLR7_520_680_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.6733 118 144 3.40.50.80
af_M0R5U3_1_190_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.5605 119 170 3.20.20.140
af_Q6P005_5_213_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5258 112 171 1.10.238.10
af_M0RC90_138_201_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5194 112 144 1.10.238.10
af_A0A1D6IKH7_71_178_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.5178 77 169 1.10.238.200
ID Description Score Start End GO Terms
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9746 105 172 GO:0005524
GO:0005886
GO:0008556
AF-A0A8B3G858-F1-model_v4 deleted 0.9714 115 172
AF-A0A2J4YSN7-F1-model_v4 Potassium-transporting ATPase subunit C (EC 3.6.3.12) 0.9648 103 170 GO:0005524
GO:0005886
GO:0008556
GO:0016787
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9608 105 172 GO:0005524
GO:0005886
GO:0008556
AF-A0A0P9DHU2-F1-model_v4 Potassium-transporting ATPase subunit C (EC 3.6.3.12) 0.9579 67 170 GO:0005524
GO:0005886
GO:0008556
GO:0016787

Feature Viewer

pLDDT pTM Quality
86.78 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map