F122693

General Info

Members Datasets Scaffolds Average Seq Length
124 104 248 160

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10338335|Ga0207699_103383352
Length 153
Sequence VGLGVDVHPFADGRVLYLAGLEWPGETGLAGHSDGDAAAHAACDALLSAAGLGDLGANFGTSRPEWAGASGVALLRETARLVGEAGYVIGNVAVYVIGNRPKIGSRRAEAAAVLSEALSGAPVSLSATTTDGLGLTGRGEGIAAMATALVVKR

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
56 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
59 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
60 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
61 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
81 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
82 2643221576 Nocardioides sp. Root614 Isolate Unclassified
83 2643221590 Nocardioides sp. Root682 Isolate Unclassified
84 2643221613 Oerskovia sp. Root22 Isolate Unclassified
85 2643221679 Angustibacter sp. Root456 Isolate Unclassified
86 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
87 2671180195 Frankia sp. CcI49 Isolate Nodule
88 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
89 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
90 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
91 2773857922 Frankia sp. CcI49 Isolate Nodule
92 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
93 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
94 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
95 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
96 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
97 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
98 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
99 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
100 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
101 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
102 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
103 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
104 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.45
Metatranscriptomes 0
Isolates 18.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 2.42
Nodule 2.42
Rhizoplane 10.48
Rhizosphere 70.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10338335 3300025906 Bacteria 1060
2 Ga0070683_100014713 3300005329 Bacteria 6852
3 Ga0070683_101748230 3300005329 Bacteria 598
4 Ga0070671_100016034 3300005355 Bacteria 6055
5 Ga0070703_10169512 3300005406 Bacteria 835
6 Ga0070714_100000010 3300005435 Bacteria 262871
7 Ga0070684_100633095 3300005535 Bacteria 995
8 Ga0070686_100651106 3300005544 Bacteria 835
9 Ga0070665_100001947 3300005548 Bacteria 23263
10 Ga0068856_101125787 3300005614 Bacteria 802
11 Ga0068852_100056840 3300005616 Bacteria 3383
12 Ga0068859_100005473 3300005617 Bacteria 12922
13 Ga0068863_100000795 3300005841 Bacteria 31676
14 Ga0068858_100005761 3300005842 Bacteria 12104
15 Ga0068860_100000297 3300005843 Bacteria 69029
16 Ga0075364_10084636 3300006051 Bacteria 2100
17 Ga0075430_100005534 3300006846 Bacteria 10670
18 Ga0075431_100000852 3300006847 Bacteria 26748
19 Ga0075431_100038138 3300006847 Bacteria 4948
20 Ga0075429_100003890 3300006880 Bacteria 12752
21 Ga0097620_100005473 3300006931 Bacteria 12922
22 Ga0111539_10504566 3300009094 Bacteria 1409
23 Ga0105247_10060997 3300009101 Bacteria 2338
24 Ga0157370_10022208 3300013104 Bacteria 6314
25 Ga0157374_10405544 3300013296 Bacteria 1360
26 Ga0163163_10413614 3300014325 Bacteria 1407
27 Ga0207710_10048975 3300025900 Bacteria 1892
28 Ga0207680_10016467 3300025903 Bacteria 3882
29 Ga0207663_10001584 3300025916 Bacteria 10685
30 Ga0207652_10020785 3300025921 Bacteria 5410
31 Ga0207664_10000009 3300025929 Bacteria 299246
32 Ga0207661_10019344 3300025944 Bacteria 5075
33 Ga0207661_11356851 3300025944 Bacteria 653
34 Ga0207703_10019387 3300026035 Bacteria 5314
35 Ga0207641_10002579 3300026088 Bacteria 16648
36 Ga0268266_10004293 3300028379 Bacteria 13719
37 Ga0268264_10000353 3300028381 Bacteria 69101
38 Ga0265340_10000127 3300031247 Bacteria 37974
39 Ga0316579_10000077 3300031691 Bacteria 24927
40 Ga0265342_10040764 3300031712 Bacteria 2814
41 Ga0307412_10376032 3300031911 Bacteria 1149
42 Ga0307409_100352143 3300031995 Bacteria 1390
43 Ga0307415_100863341 3300032126 Bacteria 831
44 Ga0451853_3994873 3300041512 Bacteria 602
45 Ga0466969_0160040 3300044656 Bacteria 1035
46 Ga0466965_0707013 3300044683 Bacteria 578
47 Ga0466966_0000724 3300044684 Bacteria 20967
48 Ga0466966_0318266 3300044684 Bacteria 935
49 Ga0466961_0020203 3300044693 Bacteria 4286
50 Ga0466961_0068969 3300044693 Bacteria 2245
51 Ga0466963_0105791 3300044694 Bacteria 1929
52 Ga0466968_0504529 3300044735 Bacteria 603
53 Ga0466957_0294086 3300044842 Bacteria 1090
54 Ga0466957_0422429 3300044842 Bacteria 915
55 Ga0466959_0005679 3300045049 Bacteria 8583
56 Ga0466959_0196498 3300045049 Bacteria 1406
57 Ga0466959_0611459 3300045049 Bacteria 733
58 Ga0466958_0059354 3300045836 Bacteria 2327
59 Ga0466967_0055067 3300045976 Bacteria 3503
60 Ga0466967_0878232 3300045976 Bacteria 891
61 Ga0466967_0933042 3300045976 Bacteria 863
62 Ga0466967_1156627 3300045976 Bacteria 771
63 Ga0496101_0133011 3300048904 Bacteria 1890
64 Ga0496102_0000029 3300048905 Bacteria 222195
65 Ga0496103_0000143 3300048906 Bacteria 74753
66 Ga0496103_0297448 3300048906 Bacteria 1038
67 Ga0496105_0324629 3300048908 Bacteria 1233
68 Ga0496108_0084621 3300048911 Bacteria 2692
69 Ga0496110_0234279 3300048913 Bacteria 1670
70 Ga0496110_1563338 3300048913 Bacteria 570
71 Ga0496111_0647649 3300048914 Bacteria 771
72 Ga0496113_0003952 3300048916 Bacteria 8999
73 Ga0496113_0489318 3300048916 Bacteria 988
74 Ga0496113_0910905 3300048916 Bacteria 695
75 Ga0496114_0856399 3300048917 Bacteria 789
76 Ga0496117_0178002 3300048920 Bacteria 1226
77 Ga0496118_0038781 3300048921 Bacteria 3813
78 Ga0496119_0023909 3300048922 Bacteria 4317
79 Ga0496121_0356860 3300048924 Bacteria 972
80 Ga0501031_0118896 3300049568 Bacteria 1727
81 Ga0501031_0760665 3300049568 Bacteria 621
82 Ga0501039_0069095 3300049575 Bacteria 2743
83 Ga0501039_0685915 3300049575 Bacteria 801
84 Ga0501042_0113975 3300049578 Bacteria 1947
85 Ga0501048_0104105 3300049582 Bacteria 2003
86 Ga0501048_0838064 3300049582 Bacteria 661
87 Ga0501067_0030738 3300049583 Bacteria 2979
88 Ga0501069_0125758 3300049585 Bacteria 1466
89 Ga0501070_0015745 3300049586 Bacteria 6359
90 Ga0501070_0666354 3300049586 Bacteria 825
91 Ga0501070_0786101 3300049586 Bacteria 748
92 Ga0501079_0970973 3300049741 Bacteria 669
93 Ga0501080_0114989 3300049742 Bacteria 2495
94 Ga0501045_0136731 3300049824 Bacteria 1822
95 nmdc:mga0yw44_29178_c1 3300050492 Bacteria 3183
96 nmdc:mga06r32_166929_c1 3300050510 Bacteria 2184
97 Ga0495619_0058849 3300053085 Bacteria 2552
98 Ga0500616_0013763 3300053153 Bacteria 4678
99 Ga0501082_0372622 3300060353 Bacteria 1245
100 Ga0466962_0039161 3300061719 Bacteria 2270
101 Ga0530510_0119011 3300061734 Bacteria 1938
102 2643890320 2643221576 Bacteria 5214352
103 2643959376 2643221590 Bacteria 5214697
104 2644080853 2643221613 Bacteria 4622396
105 2644446896 2643221679 Bacteria 3839507
106 2645725190 2643221962 Bacteria 3874254
107 2671836673 2671180195 Bacteria 9757215
108 2676489886 2675903060 Bacteria 10051191
109 2686538853 2684623035 Bacteria 8032739
110 2689995873 2687453743 Bacteria 8361025
111 2774854829 2773857922 Bacteria 9757215
112 2812373254 2811994882 Bacteria 4688362
113 2819692827 2818991462 Bacteria 4320267
114 2873314479 2873314349 Bacteria 8512634
115 2884694699 2884693830 Bacteria 11273186
116 2895433205 2895427314 Bacteria 13147766
117 2895447144 2895442618 Bacteria 11027144
118 2895889038 2895880812 Bacteria 11255272
119 2935892349 2935890801 Bacteria 4593001
120 2956940870 2956939328 Bacteria 3474458
121 2990256993 2990256926 Bacteria 4252839
122 3001120559 3001119090 Bacteria 3449530
123 8055175945 8055172936 Bacteria 9305943
124 8056062088 8056060235 Bacteria 7259403
125 Ga0207699_10338335
126 Ga0070683_100014713
127 Ga0070683_101748230
128 Ga0070671_100016034
129 Ga0070703_10169512
130 Ga0070714_100000010
131 Ga0070684_100633095
132 Ga0070686_100651106
133 Ga0070665_100001947
134 Ga0068856_101125787
135 Ga0068852_100056840
136 Ga0068859_100005473
137 Ga0068863_100000795
138 Ga0068858_100005761
139 Ga0068860_100000297
140 Ga0075364_10084636
141 Ga0075430_100005534
142 Ga0075431_100000852
143 Ga0075431_100038138
144 Ga0075429_100003890
145 Ga0097620_100005473
146 Ga0111539_10504566
147 Ga0105247_10060997
148 Ga0157370_10022208
149 Ga0157374_10405544
150 Ga0163163_10413614
151 Ga0207710_10048975
152 Ga0207680_10016467
153 Ga0207663_10001584
154 Ga0207652_10020785
155 Ga0207664_10000009
156 Ga0207661_10019344
157 Ga0207661_11356851
158 Ga0207703_10019387
159 Ga0207641_10002579
160 Ga0268266_10004293
161 Ga0268264_10000353
162 Ga0265340_10000127
163 Ga0316579_10000077
164 Ga0265342_10040764
165 Ga0307412_10376032
166 Ga0307409_100352143
167 Ga0307415_100863341
168 Ga0451853_3994873
169 Ga0466969_0160040
170 Ga0466965_0707013
171 Ga0466966_0000724
172 Ga0466966_0318266
173 Ga0466961_0020203
174 Ga0466961_0068969
175 Ga0466963_0105791
176 Ga0466968_0504529
177 Ga0466957_0294086
178 Ga0466957_0422429
179 Ga0466959_0005679
180 Ga0466959_0196498
181 Ga0466959_0611459
182 Ga0466958_0059354
183 Ga0466967_0055067
184 Ga0466967_0878232
185 Ga0466967_0933042
186 Ga0466967_1156627
187 Ga0496101_0133011
188 Ga0496102_0000029
189 Ga0496103_0000143
190 Ga0496103_0297448
191 Ga0496105_0324629
192 Ga0496108_0084621
193 Ga0496110_0234279
194 Ga0496110_1563338
195 Ga0496111_0647649
196 Ga0496113_0003952
197 Ga0496113_0489318
198 Ga0496113_0910905
199 Ga0496114_0856399
200 Ga0496117_0178002
201 Ga0496118_0038781
202 Ga0496119_0023909
203 Ga0496121_0356860
204 Ga0501031_0118896
205 Ga0501031_0760665
206 Ga0501039_0069095
207 Ga0501039_0685915
208 Ga0501042_0113975
209 Ga0501048_0104105
210 Ga0501048_0838064
211 Ga0501067_0030738
212 Ga0501069_0125758
213 Ga0501070_0015745
214 Ga0501070_0666354
215 Ga0501070_0786101
216 Ga0501079_0970973
217 Ga0501080_0114989
218 Ga0501045_0136731
219 nmdc:mga0yw44_29178_c1
220 nmdc:mga06r32_166929_c1
221 Ga0495619_0058849
222 Ga0500616_0013763
223 Ga0501082_0372622
224 Ga0466962_0039161
225 Ga0530510_0119011
226 2643890320
227 2643959376
228 2644080853
229 2644446896
230 2645725190
231 2671836673
232 2676489886
233 2686538853
234 2689995873
235 2774854829
236 2812373254
237 2819692827
238 2873314479
239 2884694699
240 2895433205
241 2895447144
242 2895889038
243 2935892349
244 2956940870
245 2990256993
246 3001120559
247 8055175945
248 8056062088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

1

151

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9707 11 164
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9654 11 164
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9522 11 164
3p10-assembly1.cif.gz_C crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol 0.9492 10 163
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.948 9 163
ID Description Score Start End Superfamily
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9754 11 163 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9508 10 163 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9504 11 163 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9342 9 163 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9278 11 164 3.30.1330.50
ID Description Score Start End GO Terms
AF-E9UXC2-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9894 10 164 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1C6TEB0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9878 11 163 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1A9GL11-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9852 7 163 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A4R7IZ23-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9838 13 164 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7V9QZ38-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9832 11 163 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Map