F120038

General Info

Members Datasets Scaffolds Average Seq Length
123 76 115 246

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0063431|Ga0501033_0063431_1258_2112
Length 284
Sequence MIFSALSKHHMSLDQKIAEALSLLDLVQRDYAPAAFANSFGAEDMVLTHLIAEHYPSIAMFTLDTGRLPEETYKLMQAVWGRYGIRVRSYFPESAAVEAYVSRHGPNGFYDSVDLRKTCCHIRKVEPLKRALRGKRAWITGLRRDQAPTRKDLAKSEFDADNGLQKFSPLLDWTLSDTWIFLKRFDVPYNALHDKGYSSIGCAPCTRAITPGEDVRAGRWWWEDPEIKECGLHPAKGTKGLHRSAIPAVDASVVPGQDGQGEERPQGPRSVEPKPRSEKIAEVD

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
6 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
7 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
8 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
26 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
27 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
28 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
29 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
33 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
34 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
35 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
36 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
37 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
40 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
41 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
42 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
50 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
56 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
71 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
72 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.5
Metatranscriptomes 0
Isolates 6.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 1.63
Rhizoplane 2.44
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10218249 3300003323 Bacteria 2378
2 Ga0070679_100095313 3300005530 Bacteria 2964
3 Ga0070695_100017564 3300005545 Bacteria 4339
4 Ga0068852_100603336 3300005616 Bacteria 1102
5 Ga0075366_10007986 3300006195 Bacteria 5861
6 Ga0075366_10099009 3300006195 Unclassified 1749
7 Ga0114129_10029186 3300009147 Bacteria 7813
8 Ga0105242_10127821 3300009176 Bacteria 2189
9 Ga0105248_10153003 3300009177 Bacteria 2603
10 Ga0105238_10313809 3300009551 Bacteria 1553
11 Ga0105239_10202132 3300010375 Bacteria 2226
12 Ga0157370_10004516 3300013104 Bacteria 15946
13 Ga0207684_10029575 3300025910 Bacteria 4663
14 Ga0207652_10068367 3300025921 Bacteria 3082
15 Ga0207659_10168758 3300025926 Bacteria 1725
16 Ga0207664_10006953 3300025929 Bacteria 7827
17 Ga0207686_10118416 3300025934 Bacteria 1798
18 Ga0265324_10003796 3300029957 Bacteria 7058
19 Ga0265324_10123210 3300029957 Bacteria 880
20 Ga0265332_10005600 3300031238 Bacteria 5781
21 Ga0265328_10000002 3300031239 Bacteria 275819
22 Ga0265325_10026698 3300031241 Bacteria 3126
23 Ga0265331_10004417 3300031250 Bacteria 8791
24 Ga0265331_10097664 3300031250 Unclassified 1354
25 Ga0265327_10000202 3300031251 Bacteria 124178
26 Ga0265327_10007193 3300031251 Bacteria 8650
27 Ga0265327_10020360 3300031251 Bacteria 4046
28 Ga0265316_10063583 3300031344 Bacteria 2861
29 Ga0307509_10000053 3300031507 Bacteria 164364
30 Ga0265314_10004831 3300031711 Bacteria 12327
31 Ga0265314_10066066 3300031711 Bacteria 2441
32 Ga0316578_10138808 3300031728 Bacteria 1464
33 Ga0316583_10008262 3300032133 Bacteria 3752
34 Ga0316583_10032352 3300032133 Bacteria 1860
35 Ga0316583_10043875 3300032133 Bacteria 1580
36 Ga0316584_0014262 3300036712 Bacteria 5652
37 Ga0316581_0000901 3300037588 Bacteria 6296
38 Ga0395901_0005452 3300038443 Bacteria 12875
39 Ga0400490_32906 3300038726 Bacteria 2521
40 Ga0436361_0749276 3300039447 Bacteria 31293
41 Ga0439433_0066705 3300041999 Bacteria 864
42 Ga0450901_010143 3300042533 Bacteria 974
43 Ga0451577_0000080 3300042876 Bacteria 218034
44 Ga0451577_0087494 3300042876 Bacteria 2779
45 Ga0451577_0374201 3300042876 Bacteria 1292
46 Ga0451577_0880570 3300042876 Bacteria 807
47 Ga0453683_0000049 3300044673 Bacteria 206697
48 Ga0453683_0040446 3300044673 Bacteria 2927
49 Ga0466965_0068005 3300044683 Bacteria 1788
50 Ga0453684_0000237 3300044712 Bacteria 236999
51 Ga0453684_0000286 3300044712 Bacteria 218034
52 Ga0453684_0001611 3300044712 Bacteria 61948
53 Ga0453684_0002678 3300044712 Bacteria 42425
54 Ga0453684_0007598 3300044712 Bacteria 19866
55 Ga0453684_0114685 3300044712 Bacteria 3266
56 Ga0453684_0297950 3300044712 Bacteria 1834
57 Ga0453684_0436101 3300044712 Bacteria 1461
58 Ga0453684_0604080 3300044712 Bacteria 1202
59 Ga0453684_0909162 3300044712 Bacteria 942
60 Ga0466957_0210770 3300044842 Bacteria 1279
61 Ga0451576_0000013 3300045051 Bacteria 665120
62 Ga0451576_0000102 3300045051 Bacteria 218034
63 Ga0451576_0002024 3300045051 Bacteria 32030
64 Ga0451576_0006122 3300045051 Bacteria 14825
65 Ga0451576_0025411 3300045051 Bacteria 6380
66 Ga0451576_0055884 3300045051 Bacteria 4129
67 Ga0451576_0283760 3300045051 Bacteria 1731
68 Ga0451576_0425891 3300045051 Bacteria 1393
69 Ga0451576_0436998 3300045051 Bacteria 1373
70 Ga0495625_0088337 3300046660 Bacteria 2147
71 Ga0495625_0130605 3300046660 Bacteria 1701
72 Ga0495686_0081696 3300047472 Bacteria 1972
73 Ga0496100_0240587 3300048903 Bacteria 1335
74 Ga0496101_0213665 3300048904 Bacteria 1495
75 Ga0496104_1218506 3300048907 Bacteria 656
76 Ga0496118_0062775 3300048921 Bacteria 2739
77 Ga0496121_0101190 3300048924 Bacteria 2223
78 Ga0501031_0233018 3300049568 Bacteria 1198
79 Ga0501032_0000164 3300049569 Bacteria 54049
80 Ga0501032_0025201 3300049569 Bacteria 4101
81 Ga0501033_0000297 3300049570 Bacteria 47732
82 Ga0501033_0006683 3300049570 Bacteria 9011
83 Ga0501033_0063431 3300049570 Bacteria 2719
84 Ga0501034_0009333 3300049571 Bacteria 10281
85 Ga0501034_0036743 3300049571 Bacteria 4960
86 Ga0501034_0139918 3300049571 Bacteria 2400
87 Ga0501036_0475239 3300049572 Bacteria 1041
88 Ga0501036_0820160 3300049572 Bacteria 765
89 Ga0501037_0000162 3300049573 Bacteria 62629
90 Ga0501038_0004302 3300049574 Bacteria 13236
91 Ga0501038_0014349 3300049574 Bacteria 7219
92 Ga0501038_0084791 3300049574 Bacteria 2665
93 Ga0501039_0063063 3300049575 Bacteria 2872
94 Ga0501039_0172275 3300049575 Bacteria 1701
95 Ga0501042_0002499 3300049578 Bacteria 11318
96 Ga0501043_0006862 3300049579 Bacteria 9089
97 Ga0501046_0001169 3300049580 Bacteria 25531
98 Ga0501046_0166375 3300049580 Bacteria 1657
99 Ga0501047_0074582 3300049581 Bacteria 3266
100 Ga0501047_0171619 3300049581 Bacteria 2037
101 Ga0501048_0003530 3300049582 Bacteria 11887
102 Ga0501048_0058709 3300049582 Bacteria 2727
103 Ga0501068_0000728 3300049584 Bacteria 16856
104 Ga0501081_0457788 3300049743 Bacteria 948
105 Ga0501280_001360 3300049776 Bacteria 4624
106 Ga0501282_003492 3300049778 Bacteria 1695
107 Ga0501035_0000199 3300049822 Bacteria 73522
108 Ga0501035_0011154 3300049822 Bacteria 8322
109 Ga0501035_0056133 3300049822 Bacteria 3515
110 Ga0501035_0065021 3300049822 Unclassified 3240
111 Ga0501044_0018949 3300049823 Bacteria 7369
112 Ga0501044_0227474 3300049823 Bacteria 1814
113 Ga0501044_0548216 3300049823 Bacteria 1054
114 Ga0501045_0004071 3300049824 Bacteria 10088
115 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1218506 Ga0496104_1218506_15_629 202
2 3300041999 Ga0439433_0066705 Ga0439433_0066705_136_849 207
3 3300049572 Ga0501036_0820160 Ga0501036_0820160_21_743 207
4 3300005545 Ga0070695_100017564 Ga0070695_1000175642 226
5 3300009147 Ga0114129_10029186 Ga0114129_100291862 226
6 3300025910 Ga0207684_10029575 Ga0207684_100295752 226
7 3300006195 Ga0075366_10007986 Ga0075366_100079864 227
8 3300050493 nmdc:mga0k408_78_c1 nmdc:mga0k408_78_c1_8884_9651 227
9 iso_pu_bacteria 2547132512 2548847692 227
10 3300006195 Ga0075366_10099009 Ga0075366_100990092 228
11 3300031238 Ga0265332_10005600 Ga0265332_100056002 228
12 3300031344 Ga0265316_10063583 Ga0265316_100635833 228
13 3300038726 Ga0400490_32906 Ga0400490_32906_74_832 228
14 3300042876 Ga0451577_0374201 Ga0451577_0374201_243_962 228
15 3300044712 Ga0453684_0001611 Ga0453684_0001611_49327_50046 228
16 3300044712 Ga0453684_0297950 Ga0453684_0297950_417_1136 228
17 3300044712 Ga0453684_0909162 Ga0453684_0909162_189_908 228
18 3300045051 Ga0451576_0025411 Ga0451576_0025411_3949_4668 228
19 3300045051 Ga0451576_0436998 Ga0451576_0436998_428_1147 228
20 3300005530 Ga0070679_100095313 Ga0070679_1000953132 229
21 3300009176 Ga0105242_10127821 Ga0105242_101278213 229
22 3300025921 Ga0207652_10068367 Ga0207652_100683672 229
23 3300025926 Ga0207659_10168758 Ga0207659_101687583 229
24 3300025934 Ga0207686_10118416 Ga0207686_101184162 229
25 3300031507 Ga0307509_10000053 Ga0307509_1000005374 229
26 3300049776 Ga0501280_001360 Ga0501280_001360_763_1491 229
27 3300049778 Ga0501282_003492 Ga0501282_003492_900_1628 229
28 3300031239 Ga0265328_10000002 Ga0265328_10000002142 230
29 3300031250 Ga0265331_10097664 Ga0265331_100976641 230
30 3300044712 Ga0453684_0007598 Ga0453684_0007598_6144_6869 230
31 3300044712 Ga0453684_0436101 Ga0453684_0436101_725_1426 230
32 3300009177 Ga0105248_10153003 Ga0105248_101530033 231
33 3300031728 Ga0316578_10138808 Ga0316578_101388082 231
34 3300032133 Ga0316583_10008262 Ga0316583_100082621 231
35 3300032133 Ga0316583_10032352 Ga0316583_100323523 231
36 3300036712 Ga0316584_0014262 Ga0316584_0014262_3446_4153 231
37 3300037588 Ga0316581_0000901 Ga0316581_0000901_4991_5698 231
38 3300049580 Ga0501046_0166375 Ga0501046_0166375_46_744 231
39 3300049581 Ga0501047_0171619 Ga0501047_0171619_347_1045 231
40 3300049823 Ga0501044_0227474 Ga0501044_0227474_436_1134 231
41 3300031251 Ga0265327_10000202 Ga0265327_1000020240 232
42 3300049568 Ga0501031_0233018 Ga0501031_0233018_40_744 232
43 3300049569 Ga0501032_0025201 Ga0501032_0025201_2017_2721 232
44 3300049571 Ga0501034_0139918 Ga0501034_0139918_96_800 232
45 3300049572 Ga0501036_0475239 Ga0501036_0475239_118_822 232
46 3300049574 Ga0501038_0084791 Ga0501038_0084791_675_1379 232
47 3300049575 Ga0501039_0172275 Ga0501039_0172275_965_1669 232
48 3300049822 Ga0501035_0056133 Ga0501035_0056133_1480_2184 232
49 3300049823 Ga0501044_0548216 Ga0501044_0548216_201_905 232
50 iso_pu_bacteria 2643221638 2644216404 232
51 3300031251 Ga0265327_10020360 Ga0265327_100203603 233
52 3300029957 Ga0265324_10123210 Ga0265324_101232101 235
53 3300031251 Ga0265327_10007193 Ga0265327_100071935 235
54 3300031711 Ga0265314_10066066 Ga0265314_100660662 235
55 3300042876 Ga0451577_0087494 Ga0451577_0087494_592_1302 235
56 3300045051 Ga0451576_0425891 Ga0451576_0425891_131_841 235
57 3300049743 Ga0501081_0457788 Ga0501081_0457788_58_804 235
58 3300029957 Ga0265324_10003796 Ga0265324_100037963 236
59 3300031241 Ga0265325_10026698 Ga0265325_100266983 236
60 3300031711 Ga0265314_10004831 Ga0265314_100048314 236
61 3300042876 Ga0451577_0880570 Ga0451577_0880570_39_752 236
62 3300044673 Ga0453683_0040446 Ga0453683_0040446_650_1363 236
63 3300044683 Ga0466965_0068005 Ga0466965_0068005_875_1597 236
64 3300044712 Ga0453684_0002678 Ga0453684_0002678_29635_30348 236
65 3300044712 Ga0453684_0114685 Ga0453684_0114685_961_1674 236
66 3300044842 Ga0466957_0210770 Ga0466957_0210770_410_1132 236
67 3300045051 Ga0451576_0000013 Ga0451576_0000013_463628_464341 236
68 3300045051 Ga0451576_0002024 Ga0451576_0002024_2698_3411 236
69 3300045051 Ga0451576_0006122 Ga0451576_0006122_1482_2195 236
70 3300045051 Ga0451576_0283760 Ga0451576_0283760_799_1512 236
71 iso_pu_bacteria 2548876994 2550697141 236
72 iso_pu_bacteria 2884811622 2884816054 236
73 iso_pu_bacteria 2884836552 2884837108 236
74 iso_pu_bacteria 2884852848 2884853400 236
75 iso_pu_bacteria 2896154374 2896155483 236
76 3300005616 Ga0068852_100603336 Ga0068852_1006033362 237
77 3300038443 Ga0395901_0005452 Ga0395901_0005452_3586_4317 237
78 3300049571 Ga0501034_0009333 Ga0501034_0009333_219_980 237
79 3300049581 Ga0501047_0074582 Ga0501047_0074582_2409_3170 237
80 3300049582 Ga0501048_0058709 Ga0501048_0058709_304_1065 237
81 3300039447 Ga0436361_0749276 Ga0436361_0749276_150_872 238
82 3300047472 Ga0495686_0081696 Ga0495686_0081696_131_862 238
83 3300009551 Ga0105238_10313809 Ga0105238_103138092 239
84 3300010375 Ga0105239_10202132 Ga0105239_102021323 239
85 3300042533 Ga0450901_010143 Ga0450901_010143_97_855 239
86 3300046660 Ga0495625_0088337 Ga0495625_0088337_848_1582 239
87 3300048903 Ga0496100_0240587 Ga0496100_0240587_429_1163 239
88 3300048904 Ga0496101_0213665 Ga0496101_0213665_258_992 239
89 3300048921 Ga0496118_0062775 Ga0496118_0062775_873_1607 239
90 3300048924 Ga0496121_0101190 Ga0496121_0101190_888_1622 239
91 3300013104 Ga0157370_10004516 Ga0157370_100045163 241
92 3300025929 Ga0207664_10006953 Ga0207664_100069535 241
93 3300049569 Ga0501032_0000164 Ga0501032_0000164_14211_15035 241
94 3300049570 Ga0501033_0000297 Ga0501033_0000297_44039_44863 241
95 3300049570 Ga0501033_0006683 Ga0501033_0006683_5961_6785 241
96 3300049571 Ga0501034_0036743 Ga0501034_0036743_1884_2708 241
97 3300049573 Ga0501037_0000162 Ga0501037_0000162_1538_2362 241
98 3300049574 Ga0501038_0014349 Ga0501038_0014349_703_1527 241
99 3300049575 Ga0501039_0063063 Ga0501039_0063063_489_1313 241
100 3300049578 Ga0501042_0002499 Ga0501042_0002499_5827_6651 241
101 3300049579 Ga0501043_0006862 Ga0501043_0006862_8167_8991 241
102 3300049580 Ga0501046_0001169 Ga0501046_0001169_20821_21645 241
103 3300049582 Ga0501048_0003530 Ga0501048_0003530_2463_3287 241
104 3300049584 Ga0501068_0000728 Ga0501068_0000728_9334_10158 241
105 3300049822 Ga0501035_0011154 Ga0501035_0011154_154_972 241
106 3300049822 Ga0501035_0065021 Ga0501035_0065021_33_857 241
107 3300049823 Ga0501044_0018949 Ga0501044_0018949_4463_5287 241
108 3300049824 Ga0501045_0004071 Ga0501045_0004071_1756_2580 241
109 3300046660 Ga0495625_0130605 Ga0495625_0130605_476_1213 242
110 3300049570 Ga0501033_0063431 Ga0501033_0063431_1258_2112 243
111 3300049574 Ga0501038_0004302 Ga0501038_0004302_4378_5232 243
112 3300049822 Ga0501035_0000199 Ga0501035_0000199_36672_37526 243
113 iso_pu_bacteria 2511231026 2511383932 243
114 3300031250 Ga0265331_10004417 Ga0265331_100044177 244
115 3300032133 Ga0316583_10043875 Ga0316583_100438752 244
116 3300042876 Ga0451577_0000080 Ga0451577_0000080_78204_78962 244
117 3300044673 Ga0453683_0000049 Ga0453683_0000049_78204_78962 244
118 3300044712 Ga0453684_0000237 Ga0453684_0000237_99494_100252 244
119 3300044712 Ga0453684_0000286 Ga0453684_0000286_139073_139831 244
120 3300044712 Ga0453684_0604080 Ga0453684_0604080_120_878 244
121 3300045051 Ga0451576_0000102 Ga0451576_0000102_78204_78962 244
122 3300045051 Ga0451576_0055884 Ga0451576_0055884_1090_1836 245
123 3300003323 rootH1_10218249 rootH1_102182491 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

33

208

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bwv-assembly1.cif.gz_B structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens 0.8703 2 194
6vpu-assembly8.cif.gz_H 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.849 3 194
7rge-assembly1.cif.gz_A crystal structure of phosphoadenylyl-sulfate (paps) reductase from candida auris, phosphate complex 0.8489 3 194
6vpu-assembly3.cif.gz_C 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.8484 3 194
1sur-assembly1.cif.gz_A-2 phospho-adenylyl-sulfate reductase 0.8326 3 194
ID Description Score Start End Superfamily
4bwvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8703 2 194 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8495 3 194 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8216 3 212 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8092 8 215 3.40.50.620
af_Q60377_225_441_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7911 2 209 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3D2FFR3-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9725 6 174 GO:0004604
GO:0019379
GO:0051536
AF-A0A3C0DY51-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9707 13 159 GO:0003824
GO:0051536
AF-A0A257Q249-F1-model_v4 Phosphoadenosine phosphosulfate reductase 0.9696 1 200 GO:0004604
GO:0019379
GO:0051536
AF-T1BZU6-F1-model_v4 Phosphoadenosine phosphosulfate reductase 0.9607 12 180 GO:0004604
GO:0005737
GO:0019379
AF-A0A520VRB1-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9604 6 173 GO:0004604
GO:0019379
GO:0051536

Feature Viewer

pLDDT pTM Quality
82.41 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map