F118021

General Info

Members Datasets Scaffolds Average Seq Length
123 99 123 267

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100038994|Ga0075431_1000389942
Length 268
Sequence MPAMHEVDYKIFGNEMQYVEVELDPNEAAVAEAGGMMYMEDGIEMETIFGDGSQQQRGFLNMLVGAGKRVLTGESLFMTVFFNRVGGGKKRVAFGAPYPGKIIPIHLAEIGGELITQRDSFLAAAKGVSIGIAFQRRLGVGLFGGEGFIMQRLQGDGWAFVHAGGTLLERTLGPNETLRVDTGCVVAMQPSVDFDIQYVGKIKSAIFGGEGLFFATLKGPGRVWLQSLPLSRLAGRIVAAVPGVSGSGRREEGSVLGALGGLLDGDNS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000818 3300003203 Bacteria 14601
2 Ga0065707_10168630 3300005295 Bacteria 1502
3 Ga0065707_10249453 3300005295 Bacteria 1130
4 Ga0070690_100073124 3300005330 Unclassified 2230
5 Ga0068869_100184068 3300005334 Bacteria 1639
6 Ga0068868_100381505 3300005338 Bacteria 1213
7 Ga0070689_100176235 3300005340 Bacteria 1734
8 Ga0070687_100193604 3300005343 Bacteria 1227
9 Ga0070668_100239808 3300005347 Bacteria 1501
10 Ga0070669_100124783 3300005353 Bacteria 1969
11 Ga0070669_100278132 3300005353 Bacteria 1340
12 Ga0070675_100495390 3300005354 Bacteria 1100
13 Ga0070674_100010976 3300005356 Bacteria 5495
14 Ga0070688_100190571 3300005365 Bacteria 1428
15 Ga0070701_10146059 3300005438 Bacteria 1357
16 Ga0070705_100016675 3300005440 Bacteria 3820
17 Ga0070705_100103748 3300005440 Bacteria 1801
18 Ga0070705_100185311 3300005440 Bacteria 1413
19 Ga0070700_100224044 3300005441 Bacteria 1334
20 Ga0070662_100103205 3300005457 Bacteria 2162
21 Ga0070695_100150393 3300005545 Unclassified 1624
22 Ga0070696_100392605 3300005546 Bacteria 1084
23 Ga0070704_100389099 3300005549 Bacteria 1187
24 Ga0068855_100001309 3300005563 Bacteria 30831
25 Ga0068856_100003720 3300005614 Bacteria 15306
26 Ga0068859_100125326 3300005617 Bacteria 2637
27 Ga0068859_100256567 3300005617 Bacteria 1839
28 Ga0068861_100127413 3300005719 Bacteria 2062
29 Ga0068862_100433681 3300005844 Bacteria 1235
30 Ga0081539_10000159 3300005985 Bacteria 157561
31 Ga0075364_10212368 3300006051 Bacteria 1312
32 Ga0070712_100041094 3300006175 Bacteria 3173
33 Ga0097621_100029449 3300006237 Bacteria 4336
34 Ga0075431_100038994 3300006847 Bacteria 4894
35 Ga0075433_10063814 3300006852 Bacteria 3228
36 Ga0097620_100125327 3300006931 Bacteria 2637
37 Ga0097620_100256564 3300006931 Bacteria 1839
38 Ga0105240_10027511 3300009093 Bacteria 7443
39 Ga0111539_10164232 3300009094 Bacteria 2597
40 Ga0114129_10020179 3300009147 Bacteria 9484
41 Ga0114129_10654413 3300009147 Bacteria 1356
42 Ga0105243_10092544 3300009148 Bacteria 2493
43 Ga0105242_10027373 3300009176 Bacteria 4526
44 Ga0105248_10408796 3300009177 Bacteria 1528
45 Ga0105248_10744146 3300009177 Bacteria 1106
46 Ga0105237_10115170 3300009545 Bacteria 2681
47 Ga0105238_10073261 3300009551 Bacteria 3420
48 Ga0105249_10103837 3300009553 Bacteria 2677
49 Ga0157369_10098963 3300013105 Bacteria 3109
50 Ga0163162_10042281 3300013306 Bacteria 4560
51 Ga0157375_10358753 3300013308 Bacteria 1624
52 Ga0163163_10000063 3300014325 Bacteria 117632
53 Ga0157380_10051393 3300014326 Bacteria 3260
54 Ga0157380_10184695 3300014326 Bacteria 1835
55 Ga0157380_10265401 3300014326 Bacteria 1562
56 Ga0207680_10023136 3300025903 Unclassified 3389
57 Ga0207695_10405935 3300025913 Bacteria 1247
58 Ga0207671_10132062 3300025914 Bacteria 1917
59 Ga0207681_10041356 3300025923 Bacteria 3072
60 Ga0207681_10079406 3300025923 Bacteria 2312
61 Ga0207681_10244487 3300025923 Bacteria 1398
62 Ga0207694_10052288 3300025924 Bacteria 3167
63 Ga0207686_10182695 3300025934 Bacteria 1488
64 Ga0207709_10198218 3300025935 Bacteria 1432
65 Ga0207670_10097256 3300025936 Bacteria 2095
66 Ga0207670_10100875 3300025936 Bacteria 2062
67 Ga0207711_10222095 3300025941 Bacteria 1728
68 Ga0207667_10029025 3300025949 Bacteria 6004
69 Ga0207712_10097712 3300025961 Bacteria 2176
70 Ga0207712_10109886 3300025961 Bacteria 2066
71 Ga0207702_10284918 3300026078 Bacteria 1563
72 Ga0207641_10199977 3300026088 Unclassified 1842
73 Ga0207641_10378878 3300026088 Bacteria 1354
74 Ga0207675_100048605 3300026118 Bacteria 3960
75 Ga0207675_100076661 3300026118 Bacteria 3131
76 Ga0207428_10012420 3300027907 Bacteria 7484
77 Ga0268265_10349532 3300028380 Bacteria 1349
78 Ga0307515_10128951 3300028794 Bacteria 2801
79 Ga0316576_10069781 3300031727 Bacteria 2591
80 Ga0307405_10383480 3300031731 Bacteria 1095
81 Ga0307406_10275348 3300031901 Bacteria 1281
82 Ga0307416_100577871 3300032002 Bacteria 1201
83 Ga0307414_10312818 3300032004 Bacteria 1334
84 Ga0373936_0092182 3300035113 Bacteria 1271
85 Ga0373935_0125186 3300035692 Bacteria 1721
86 Ga0439435_0017139 3300042436 Bacteria 1827
87 Ga0451577_0012722 3300042876 Bacteria 7895
88 Ga0453683_0000873 3300044673 Bacteria 28991
89 Ga0453684_0000001 3300044712 Bacteria 2623166
90 Ga0453684_0113081 3300044712 Bacteria 3294
91 Ga0451576_0034730 3300045051 Bacteria 5355
92 Ga0451576_0050625 3300045051 Bacteria 4356
93 Ga0451576_0054042 3300045051 Bacteria 4205
94 Ga0451576_0107486 3300045051 Bacteria 2903
95 Ga0451576_0123889 3300045051 Bacteria 2692
96 Ga0495592_0357772 3300046454 Bacteria 934
97 Ga0495638_0265617 3300046460 Bacteria 939
98 Ga0495641_0052316 3300046461 Bacteria 1862
99 Ga0495666_0081071 3300046526 Bacteria 1535
100 Ga0495640_0202142 3300046533 Bacteria 1259
101 Ga0495586_0022918 3300046535 Bacteria 3333
102 Ga0495586_0044513 3300046535 Bacteria 2392
103 Ga0495634_0289352 3300046642 Bacteria 993
104 Ga0495657_0051976 3300046675 Bacteria 2750
105 Ga0495647_0079873 3300046681 Bacteria 1325
106 Ga0495613_0105623 3300046689 Bacteria 2033
107 Ga0501046_0239347 3300049580 Bacteria 1339
108 Ga0501047_0209301 3300049581 Bacteria 1809
109 Ga0501074_0168062 3300049590 Bacteria 1566
110 Ga0501075_0029958 3300049591 Bacteria 4027
111 Ga0501075_0293245 3300049591 Bacteria 1239
112 Ga0501083_0002418 3300049744 Bacteria 12764
113 Ga0501044_0018692 3300049823 Bacteria 7423
114 Ga0501045_0078903 3300049824 Bacteria 2427
115 nmdc:mga00v17_117236_c1 3300050491 Bacteria 1693
116 nmdc:mga0qj67_95294_c1 3300050509 Bacteria 2395
117 nmdc:mga06r32_38487_c1 3300050510 Bacteria 4532
118 nmdc:mga08y16_109466_c1 3300050511 Bacteria 2876
119 nmdc:mga08y16_240_c1 3300050511 Bacteria 49059
120 nmdc:mga0a205_246901_c1 3300050515 Bacteria 1665
121 Ga0500583_0001775 3300053092 Bacteria 6312
122 Ga0501082_0542312 3300060353 Bacteria 1017
123 Ga0530510_0529163 3300061734 Bacteria 894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10654413 Ga0114129_106544131 264
2 3300046454 Ga0495592_0357772 Ga0495592_0357772_42_857 264
3 3300050509 nmdc:mga0qj67_95294_c1 nmdc:mga0qj67_95294_c1_1251_2048 264
4 3300050510 nmdc:mga06r32_38487_c1 nmdc:mga06r32_38487_c1_3505_4302 264
5 3300005295 Ga0065707_10249453 Ga0065707_102494531 265
6 3300005334 Ga0068869_100184068 Ga0068869_1001840682 265
7 3300005338 Ga0068868_100381505 Ga0068868_1003815051 265
8 3300005353 Ga0070669_100124783 Ga0070669_1001247832 265
9 3300005719 Ga0068861_100127413 Ga0068861_1001274132 265
10 3300006237 Ga0097621_100029449 Ga0097621_1000294493 265
11 3300009177 Ga0105248_10744146 Ga0105248_107441462 265
12 3300014326 Ga0157380_10184695 Ga0157380_101846951 265
13 3300025923 Ga0207681_10079406 Ga0207681_100794061 265
14 3300025923 Ga0207681_10244487 Ga0207681_102444872 265
15 3300050511 nmdc:mga08y16_109466_c1 nmdc:mga08y16_109466_c1_2049_2849 265
16 3300005295 Ga0065707_10168630 Ga0065707_101686301 266
17 3300005330 Ga0070690_100073124 Ga0070690_1000731241 266
18 3300005340 Ga0070689_100176235 Ga0070689_1001762352 266
19 3300005343 Ga0070687_100193604 Ga0070687_1001936041 266
20 3300005347 Ga0070668_100239808 Ga0070668_1002398082 266
21 3300005353 Ga0070669_100278132 Ga0070669_1002781321 266
22 3300005354 Ga0070675_100495390 Ga0070675_1004953901 266
23 3300005356 Ga0070674_100010976 Ga0070674_1000109763 266
24 3300005365 Ga0070688_100190571 Ga0070688_1001905711 266
25 3300005438 Ga0070701_10146059 Ga0070701_101460592 266
26 3300005440 Ga0070705_100016675 Ga0070705_1000166754 266
27 3300005440 Ga0070705_100103748 Ga0070705_1001037482 266
28 3300005440 Ga0070705_100185311 Ga0070705_1001853111 266
29 3300005441 Ga0070700_100224044 Ga0070700_1002240441 266
30 3300005457 Ga0070662_100103205 Ga0070662_1001032053 266
31 3300005545 Ga0070695_100150393 Ga0070695_1001503932 266
32 3300005546 Ga0070696_100392605 Ga0070696_1003926052 266
33 3300005549 Ga0070704_100389099 Ga0070704_1003890992 266
34 3300005563 Ga0068855_100001309 Ga0068855_1000013094 266
35 3300005614 Ga0068856_100003720 Ga0068856_1000037202 266
36 3300005617 Ga0068859_100125326 Ga0068859_1001253263 266
37 3300005617 Ga0068859_100256567 Ga0068859_1002565671 266
38 3300005844 Ga0068862_100433681 Ga0068862_1004336812 266
39 3300006051 Ga0075364_10212368 Ga0075364_102123682 266
40 3300006852 Ga0075433_10063814 Ga0075433_100638143 266
41 3300006931 Ga0097620_100125327 Ga0097620_1001253273 266
42 3300006931 Ga0097620_100256564 Ga0097620_1002565641 266
43 3300009093 Ga0105240_10027511 Ga0105240_100275114 266
44 3300009094 Ga0111539_10164232 Ga0111539_101642322 266
45 3300009147 Ga0114129_10020179 Ga0114129_100201792 266
46 3300009148 Ga0105243_10092544 Ga0105243_100925444 266
47 3300009176 Ga0105242_10027373 Ga0105242_100273734 266
48 3300009177 Ga0105248_10408796 Ga0105248_104087962 266
49 3300009545 Ga0105237_10115170 Ga0105237_101151702 266
50 3300009551 Ga0105238_10073261 Ga0105238_100732612 266
51 3300009553 Ga0105249_10103837 Ga0105249_101038372 266
52 3300013105 Ga0157369_10098963 Ga0157369_100989634 266
53 3300013306 Ga0163162_10042281 Ga0163162_100422814 266
54 3300013308 Ga0157375_10358753 Ga0157375_103587532 266
55 3300014325 Ga0163163_10000063 Ga0163163_1000006388 266
56 3300014326 Ga0157380_10265401 Ga0157380_102654013 266
57 3300025903 Ga0207680_10023136 Ga0207680_100231362 266
58 3300025913 Ga0207695_10405935 Ga0207695_104059352 266
59 3300025914 Ga0207671_10132062 Ga0207671_101320622 266
60 3300025923 Ga0207681_10041356 Ga0207681_100413564 266
61 3300025924 Ga0207694_10052288 Ga0207694_100522883 266
62 3300025934 Ga0207686_10182695 Ga0207686_101826952 266
63 3300025935 Ga0207709_10198218 Ga0207709_101982181 266
64 3300025936 Ga0207670_10097256 Ga0207670_100972562 266
65 3300025936 Ga0207670_10100875 Ga0207670_101008752 266
66 3300025941 Ga0207711_10222095 Ga0207711_102220952 266
67 3300025949 Ga0207667_10029025 Ga0207667_100290254 266
68 3300025961 Ga0207712_10097712 Ga0207712_100977122 266
69 3300025961 Ga0207712_10109886 Ga0207712_101098863 266
70 3300026078 Ga0207702_10284918 Ga0207702_102849181 266
71 3300026088 Ga0207641_10199977 Ga0207641_101999772 266
72 3300026088 Ga0207641_10378878 Ga0207641_103788782 266
73 3300026118 Ga0207675_100048605 Ga0207675_1000486054 266
74 3300026118 Ga0207675_100076661 Ga0207675_1000766613 266
75 3300027907 Ga0207428_10012420 Ga0207428_100124203 266
76 3300028380 Ga0268265_10349532 Ga0268265_103495322 266
77 3300028794 Ga0307515_10128951 Ga0307515_101289513 266
78 3300031727 Ga0316576_10069781 Ga0316576_100697813 266
79 3300031731 Ga0307405_10383480 Ga0307405_103834802 266
80 3300031901 Ga0307406_10275348 Ga0307406_102753482 266
81 3300032002 Ga0307416_100577871 Ga0307416_1005778711 266
82 3300032004 Ga0307414_10312818 Ga0307414_103128182 266
83 3300042436 Ga0439435_0017139 Ga0439435_0017139_975_1775 266
84 3300042876 Ga0451577_0012722 Ga0451577_0012722_5112_5954 266
85 3300044673 Ga0453683_0000873 Ga0453683_0000873_25381_26181 266
86 3300044712 Ga0453684_0000001 Ga0453684_0000001_187350_188348 266
87 3300044712 Ga0453684_0113081 Ga0453684_0113081_950_1750 266
88 3300045051 Ga0451576_0034730 Ga0451576_0034730_2692_3492 266
89 3300045051 Ga0451576_0050625 Ga0451576_0050625_3036_3836 266
90 3300045051 Ga0451576_0054042 Ga0451576_0054042_3329_4129 266
91 3300045051 Ga0451576_0107486 Ga0451576_0107486_1476_2318 266
92 3300045051 Ga0451576_0123889 Ga0451576_0123889_1562_2404 266
93 3300046460 Ga0495638_0265617 Ga0495638_0265617_93_893 266
94 3300046461 Ga0495641_0052316 Ga0495641_0052316_668_1468 266
95 3300046533 Ga0495640_0202142 Ga0495640_0202142_97_897 266
96 3300046535 Ga0495586_0044513 Ga0495586_0044513_1330_2130 266
97 3300046642 Ga0495634_0289352 Ga0495634_0289352_87_887 266
98 3300046675 Ga0495657_0051976 Ga0495657_0051976_142_942 266
99 3300046681 Ga0495647_0079873 Ga0495647_0079873_129_929 266
100 3300046689 Ga0495613_0105623 Ga0495613_0105623_630_1430 266
101 3300049580 Ga0501046_0239347 Ga0501046_0239347_426_1226 266
102 3300049581 Ga0501047_0209301 Ga0501047_0209301_67_894 266
103 3300049590 Ga0501074_0168062 Ga0501074_0168062_720_1523 266
104 3300049591 Ga0501075_0029958 Ga0501075_0029958_1087_1887 266
105 3300049591 Ga0501075_0293245 Ga0501075_0293245_375_1175 266
106 3300049744 Ga0501083_0002418 Ga0501083_0002418_3913_4740 266
107 3300049823 Ga0501044_0018692 Ga0501044_0018692_2285_3112 266
108 3300049824 Ga0501045_0078903 Ga0501045_0078903_1095_1895 266
109 3300050491 nmdc:mga00v17_117236_c1 nmdc:mga00v17_117236_c1_379_1179 266
110 3300050511 nmdc:mga08y16_240_c1 nmdc:mga08y16_240_c1_33613_34413 266
111 3300050515 nmdc:mga0a205_246901_c1 nmdc:mga0a205_246901_c1_38_838 266
112 3300053092 Ga0500583_0001775 Ga0500583_0001775_772_1572 266
113 3300060353 Ga0501082_0542312 Ga0501082_0542312_138_938 266
114 3300061734 Ga0530510_0529163 Ga0530510_0529163_48_848 266
115 3300006175 Ga0070712_100041094 Ga0070712_1000410942 267
116 3300006847 Ga0075431_100038994 Ga0075431_1000389942 267
117 3300014326 Ga0157380_10051393 Ga0157380_100513933 267
118 3300035113 Ga0373936_0092182 Ga0373936_0092182_448_1251 267
119 3300035692 Ga0373935_0125186 Ga0373935_0125186_623_1426 267
120 3300046526 Ga0495666_0081071 Ga0495666_0081071_457_1260 267
121 3300046535 Ga0495586_0022918 Ga0495586_0022918_613_1416 267
122 3300003203 JGI25406J46586_10000818 JGI25406J46586_100008188 269
123 3300005985 Ga0081539_10000159 Ga0081539_1000015967 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01987

AIM24

Mitochondrial biogenesis AIM24

9

228

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9513 6 242
1yox-assembly1.cif.gz_B structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9198 5 243
1yox-assembly2.cif.gz_E structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9117 5 243
1yox-assembly2.cif.gz_F structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.91 5 242
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9026 6 242
ID Description Score Start End Superfamily
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.956 6 242 3.60.160.10
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.9061 6 242 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.881 7 242 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8514 7 242 3.60.160.10
af_Q84J77_18_258_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8125 6 245 3.60.160.10
ID Description Score Start End GO Terms
AF-A0A7S3PHG5-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.8734 114 255
AF-A0A0B7KS74-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.8706 99 243 GO:0005739
AF-A0A7S1D4J1-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.8685 144 245
AF-A0A1V6A2Q7-F1-model_v4 Mitochondrial biogenesis AIM24 0.8664 98 243
AF-A0A075FYY3-F1-model_v4 TIGR00266 family protein 0.8607 98 245

Feature Viewer

pLDDT pTM Quality
70.43 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map