F116602

General Info

Members Datasets Scaffolds Average Seq Length
123 105 123 156

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10100772|JGI24735J21928_101007721
Length 154
Sequence MSRVQLALRVADLXXSITFYESLFGVAPAKRRPGYANFAIAEPPLKLVLIEGEAGVPTALDHLGVEVETTDEVNTATTRLSELGLFTAVQNDTTCCYAVQDKVWVHGPGQEPWEVYTVKADAPDDTSIRPVDQPDADACCAAPAGTEQAVSSCC

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 4.07
Rhizosphere 86.18
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10100772 3300002067 Bacteria 829
2 rootH1_10110636 3300003316 Bacteria 1223
3 rootL2_10155523 3300003322 Bacteria 2846
4 Ga0068869_100423975 3300005334 Bacteria 1098
5 Ga0070682_100001723 3300005337 Bacteria 12159
6 Ga0068868_101347363 3300005338 Bacteria 664
7 Ga0070710_11252034 3300005437 Bacteria 550
8 Ga0070681_11075208 3300005458 Bacteria 725
9 Ga0070681_11413954 3300005458 Bacteria 619
10 Ga0070685_10698361 3300005466 Unclassified 739
11 Ga0070707_100468271 3300005468 Bacteria 1221
12 Ga0070698_100034649 3300005471 Bacteria 5224
13 Ga0070698_101398891 3300005471 Bacteria 650
14 Ga0070679_100000418 3300005530 Bacteria 36225
15 Ga0070684_100399976 3300005535 Bacteria 1266
16 Ga0068853_100002285 3300005539 Bacteria 14317
17 Ga0070693_100276882 3300005547 Bacteria 1122
18 Ga0070665_100472693 3300005548 Bacteria 1264
19 Ga0070665_100755759 3300005548 Bacteria 985
20 Ga0070704_100689008 3300005549 Bacteria 905
21 Ga0068855_100043690 3300005563 Bacteria 5307
22 Ga0068854_101345340 3300005578 Bacteria 644
23 Ga0068852_100087003 3300005616 Bacteria 2787
24 Ga0068852_100852290 3300005616 Bacteria 927
25 Ga0068859_100018565 3300005617 Bacteria 6990
26 Ga0068862_100248792 3300005844 Bacteria 1619
27 Ga0070717_10752341 3300006028 Bacteria 886
28 Ga0075366_10453627 3300006195 Bacteria 791
29 Ga0075428_101747152 3300006844 Unclassified 648
30 Ga0075430_100276246 3300006846 Bacteria 1390
31 Ga0075430_101198065 3300006846 Bacteria 625
32 Ga0075429_100478510 3300006880 Bacteria 1091
33 Ga0068865_100814862 3300006881 Bacteria 806
34 Ga0097620_100018565 3300006931 Bacteria 6990
35 Ga0075435_100176951 3300007076 Bacteria 1802
36 Ga0099795_10199513 3300007788 Bacteria 843
37 Ga0111539_11463531 3300009094 Bacteria 792
38 Ga0105247_10013307 3300009101 Bacteria 4938
39 Ga0105238_10007233 3300009551 Bacteria 11111
40 Ga0157372_11178015 3300013307 Bacteria 886
41 Ga0207692_11008118 3300025898 Bacteria 550
42 Ga0207710_10010404 3300025900 Bacteria 3918
43 Ga0207707_11047233 3300025912 Bacteria 667
44 Ga0207660_10480394 3300025917 Bacteria 1007
45 Ga0207652_10009643 3300025921 Bacteria 7767
46 Ga0207646_10986294 3300025922 Bacteria 745
47 Ga0207694_10018643 3300025924 Bacteria 5246
48 Ga0207700_10262865 3300025928 Bacteria 1478
49 Ga0207689_10817045 3300025942 Bacteria 787
50 Ga0207640_11042219 3300025981 Bacteria 721
51 Ga0207677_11052594 3300026023 Bacteria 740
52 Ga0207639_10001699 3300026041 Bacteria 14856
53 Ga0207675_101496274 3300026118 Bacteria 696
54 Ga0207428_10348726 3300027907 Bacteria 1089
55 Ga0265340_10199426 3300031247 Bacteria 900
56 Ga0307513_10261671 3300031456 Bacteria 1519
57 Ga0265313_10117297 3300031595 Unclassified 1164
58 Ga0307508_10002034 3300031616 Bacteria 21885
59 Ga0307412_10033350 3300031911 Bacteria 3272
60 Ga0373934_0049177 3300035086 Bacteria 1669
61 Ga0373936_0447297 3300035113 Bacteria 597
62 Ga0373945_0259987 3300035116 Bacteria 735
63 Ga0373954_0102627 3300035118 Bacteria 1381
64 Ga0373957_0133718 3300035120 Bacteria 1011
65 Ga0373943_0015287 3300035170 Bacteria 3485
66 Ga0373946_0096063 3300035171 Bacteria 1321
67 Ga0373955_0029269 3300035172 Bacteria 2863
68 Ga0373955_0174333 3300035172 Bacteria 1274
69 Ga0373924_0337608 3300035410 Bacteria 671
70 Ga0373927_0169406 3300035695 Bacteria 1431
71 Ga0373927_0280140 3300035695 Bacteria 1097
72 Ga0373927_0447000 3300035695 Bacteria 854
73 Ga0373933_0006220 3300035724 Bacteria 6496
74 Ga0373947_0176212 3300035725 Bacteria 1390
75 Ga0373937_0260150 3300036401 Bacteria 1636
76 Ga0373937_0315768 3300036401 Bacteria 1478
77 Ga0373925_0009672 3300037068 Bacteria 7015
78 Ga0436364_0368048 3300037853 Bacteria 888
79 Ga0436365_0478521 3300039437 Bacteria 1992
80 Ga0451849_0290576 3300041505 Bacteria 10063
81 Ga0451851_1253466 3300041507 Bacteria 1390
82 Ga0451843_1681854 3300041509 Bacteria 1284
83 Ga0451853_2378664 3300041512 Bacteria 9541
84 Ga0466959_0153023 3300045049 Bacteria 1625
85 Ga0495664_0081948 3300046477 Bacteria 1934
86 Ga0495628_0260312 3300046516 Bacteria 1293
87 Ga0495630_0067853 3300046517 Bacteria 2681
88 Ga0495586_0161694 3300046535 Bacteria 1263
89 Ga0495634_0006003 3300046642 Bacteria 9270
90 Ga0495635_0253950 3300046663 Bacteria 1185
91 Ga0495599_0047112 3300046678 Bacteria 2702
92 Ga0495599_0425395 3300046678 Bacteria 789
93 Ga0495581_0070626 3300047315 Bacteria 2020
94 Ga0495674_0008330 3300047319 Bacteria 9881
95 Ga0495680_0148103 3300047322 Bacteria 1713
96 Ga0496104_0030428 3300048907 Bacteria 5017
97 Ga0496104_0649165 3300048907 Bacteria 964
98 Ga0496108_0458811 3300048911 Bacteria 1113
99 Ga0496114_0560171 3300048917 Bacteria 1009
100 Ga0496115_0024861 3300048918 Bacteria 4659
101 Ga0501047_0051911 3300049581 Bacteria 3963
102 Ga0501047_0460560 3300049581 Bacteria 1100
103 Ga0501067_0005419 3300049583 Bacteria 7084
104 Ga0501067_0455626 3300049583 Bacteria 714
105 Ga0501068_0345758 3300049584 Unclassified 955
106 Ga0501069_0054849 3300049585 Bacteria 2220
107 Ga0501073_0010323 3300049589 Bacteria 6857
108 Ga0501076_0130518 3300049592 Bacteria 2038
109 Ga0501083_0010298 3300049744 Bacteria 6588
110 nmdc:mga0k408_410880_c1 3300050493 Bacteria 805
111 nmdc:mga05p37_1540860_c1 3300050507 Bacteria 659
112 nmdc:mga0qj67_1058724_c1 3300050509 Bacteria 635
113 nmdc:mga0qj67_303610_c1 3300050509 Bacteria 1293
114 nmdc:mga08y16_1100995_c1 3300050511 Bacteria 769
115 nmdc:mga08y16_40552_c1 3300050511 Bacteria 4879
116 nmdc:mga0rr50_825670_c1 3300050513 Bacteria 791
117 Ga0495601_0130116 3300053077 Bacteria 1639
118 Ga0495595_0082355 3300053084 Bacteria 1535
119 Ga0501084_0002328 3300054114 Bacteria 15262
120 Ga0501084_0011590 3300054114 Bacteria 7297
121 Ga0501084_0021531 3300054114 Bacteria 5374
122 Ga0501084_0025284 3300054114 Bacteria 4953
123 Ga0501082_0043906 3300060353 Bacteria 3856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10199513 Ga0099795_101995132 133
2 3300005458 Ga0070681_11075208 Ga0070681_110752082 136
3 3300025912 Ga0207707_11047233 Ga0207707_110472332 136
4 3300005549 Ga0070704_100689008 Ga0070704_1006890081 139
5 3300005844 Ga0068862_100248792 Ga0068862_1002487923 139
6 3300006846 Ga0075430_100276246 Ga0075430_1002762463 139
7 3300006846 Ga0075430_101198065 Ga0075430_1011980651 139
8 3300007076 Ga0075435_100176951 Ga0075435_1001769513 139
9 3300047315 Ga0495581_0070626 Ga0495581_0070626_675_1160 139
10 3300050507 nmdc:mga05p37_1540860_c1 nmdc:mga05p37_1540860_c1_20_469 139
11 3300050509 nmdc:mga0qj67_1058724_c1 nmdc:mga0qj67_1058724_c1_53_508 139
12 3300050509 nmdc:mga0qj67_303610_c1 nmdc:mga0qj67_303610_c1_219_668 139
13 3300050513 nmdc:mga0rr50_825670_c1 nmdc:mga0rr50_825670_c1_120_566 139
14 3300031616 Ga0307508_10002034 Ga0307508_100020343 141
15 3300035695 Ga0373927_0169406 Ga0373927_0169406_86_565 142
16 3300037068 Ga0373925_0009672 Ga0373925_0009672_756_1235 142
17 3300045049 Ga0466959_0153023 Ga0466959_0153023_656_1135 142
18 3300005471 Ga0070698_100034649 Ga0070698_1000346493 143
19 3300035086 Ga0373934_0049177 Ga0373934_0049177_733_1206 143
20 3300036401 Ga0373937_0315768 Ga0373937_0315768_878_1333 143
21 3300005466 Ga0070685_10698361 Ga0070685_106983612 144
22 3300005547 Ga0070693_100276882 Ga0070693_1002768822 144
23 3300003316 rootH1_10110636 rootH1_101106362 145
24 3300003322 rootL2_10155523 rootL2_101555233 145
25 3300005334 Ga0068869_100423975 Ga0068869_1004239752 145
26 3300005337 Ga0070682_100001723 Ga0070682_1000017234 145
27 3300005338 Ga0068868_101347363 Ga0068868_1013473632 145
28 3300005437 Ga0070710_11252034 Ga0070710_112520341 145
29 3300005458 Ga0070681_11413954 Ga0070681_114139541 145
30 3300005468 Ga0070707_100468271 Ga0070707_1004682711 145
31 3300005471 Ga0070698_101398891 Ga0070698_1013988911 145
32 3300005530 Ga0070679_100000418 Ga0070679_10000041811 145
33 3300005535 Ga0070684_100399976 Ga0070684_1003999762 145
34 3300005539 Ga0068853_100002285 Ga0068853_10000228519 145
35 3300005548 Ga0070665_100472693 Ga0070665_1004726932 145
36 3300005548 Ga0070665_100755759 Ga0070665_1007557592 145
37 3300005563 Ga0068855_100043690 Ga0068855_1000436907 145
38 3300005578 Ga0068854_101345340 Ga0068854_1013453401 145
39 3300005616 Ga0068852_100087003 Ga0068852_1000870033 145
40 3300005616 Ga0068852_100852290 Ga0068852_1008522902 145
41 3300005617 Ga0068859_100018565 Ga0068859_1000185658 145
42 3300006028 Ga0070717_10752341 Ga0070717_107523411 145
43 3300006195 Ga0075366_10453627 Ga0075366_104536272 145
44 3300006844 Ga0075428_101747152 Ga0075428_1017471521 145
45 3300006880 Ga0075429_100478510 Ga0075429_1004785101 145
46 3300006881 Ga0068865_100814862 Ga0068865_1008148622 145
47 3300006931 Ga0097620_100018565 Ga0097620_1000185655 145
48 3300009094 Ga0111539_11463531 Ga0111539_114635311 145
49 3300009101 Ga0105247_10013307 Ga0105247_100133077 145
50 3300009551 Ga0105238_10007233 Ga0105238_100072338 145
51 3300013307 Ga0157372_11178015 Ga0157372_111780152 145
52 3300025898 Ga0207692_11008118 Ga0207692_110081181 145
53 3300025900 Ga0207710_10010404 Ga0207710_100104044 145
54 3300025917 Ga0207660_10480394 Ga0207660_104803942 145
55 3300025921 Ga0207652_10009643 Ga0207652_100096432 145
56 3300025922 Ga0207646_10986294 Ga0207646_109862941 145
57 3300025924 Ga0207694_10018643 Ga0207694_100186437 145
58 3300025928 Ga0207700_10262865 Ga0207700_102628652 145
59 3300025942 Ga0207689_10817045 Ga0207689_108170452 145
60 3300025981 Ga0207640_11042219 Ga0207640_110422192 145
61 3300026023 Ga0207677_11052594 Ga0207677_110525941 145
62 3300026041 Ga0207639_10001699 Ga0207639_1000169912 145
63 3300026118 Ga0207675_101496274 Ga0207675_1014962741 145
64 3300027907 Ga0207428_10348726 Ga0207428_103487262 145
65 3300031247 Ga0265340_10199426 Ga0265340_101994262 145
66 3300031456 Ga0307513_10261671 Ga0307513_102616712 145
67 3300031595 Ga0265313_10117297 Ga0265313_101172972 145
68 3300031911 Ga0307412_10033350 Ga0307412_100333502 145
69 3300035113 Ga0373936_0447297 Ga0373936_0447297_96_584 145
70 3300035116 Ga0373945_0259987 Ga0373945_0259987_202_669 145
71 3300035118 Ga0373954_0102627 Ga0373954_0102627_118_585 145
72 3300035120 Ga0373957_0133718 Ga0373957_0133718_260_730 145
73 3300035170 Ga0373943_0015287 Ga0373943_0015287_2817_3290 145
74 3300035171 Ga0373946_0096063 Ga0373946_0096063_25_492 145
75 3300035172 Ga0373955_0029269 Ga0373955_0029269_581_1048 145
76 3300035172 Ga0373955_0174333 Ga0373955_0174333_60_527 145
77 3300035410 Ga0373924_0337608 Ga0373924_0337608_52_519 145
78 3300035695 Ga0373927_0280140 Ga0373927_0280140_212_685 145
79 3300035695 Ga0373927_0447000 Ga0373927_0447000_40_507 145
80 3300035724 Ga0373933_0006220 Ga0373933_0006220_4821_5288 145
81 3300035725 Ga0373947_0176212 Ga0373947_0176212_149_622 145
82 3300036401 Ga0373937_0260150 Ga0373937_0260150_609_1076 145
83 3300037853 Ga0436364_0368048 Ga0436364_0368048_16_495 145
84 3300039437 Ga0436365_0478521 Ga0436365_0478521_1309_1953 145
85 3300041505 Ga0451849_0290576 Ga0451849_0290576_240_779 145
86 3300041507 Ga0451851_1253466 Ga0451851_1253466_524_1063 145
87 3300041509 Ga0451843_1681854 Ga0451843_1681854_186_725 145
88 3300041512 Ga0451853_2378664 Ga0451853_2378664_4301_4840 145
89 3300046477 Ga0495664_0081948 Ga0495664_0081948_477_944 145
90 3300046516 Ga0495628_0260312 Ga0495628_0260312_149_628 145
91 3300046517 Ga0495630_0067853 Ga0495630_0067853_1947_2414 145
92 3300046535 Ga0495586_0161694 Ga0495586_0161694_457_924 145
93 3300046642 Ga0495634_0006003 Ga0495634_0006003_4399_4866 145
94 3300046663 Ga0495635_0253950 Ga0495635_0253950_49_516 145
95 3300046678 Ga0495599_0047112 Ga0495599_0047112_509_976 145
96 3300046678 Ga0495599_0425395 Ga0495599_0425395_87_566 145
97 3300047319 Ga0495674_0008330 Ga0495674_0008330_3753_4220 145
98 3300047322 Ga0495680_0148103 Ga0495680_0148103_1032_1511 145
99 3300048907 Ga0496104_0030428 Ga0496104_0030428_401_883 145
100 3300048907 Ga0496104_0649165 Ga0496104_0649165_30_497 145
101 3300048911 Ga0496108_0458811 Ga0496108_0458811_314_781 145
102 3300048917 Ga0496114_0560171 Ga0496114_0560171_111_581 145
103 3300048918 Ga0496115_0024861 Ga0496115_0024861_2732_3202 145
104 3300049581 Ga0501047_0051911 Ga0501047_0051911_2549_3028 145
105 3300049581 Ga0501047_0460560 Ga0501047_0460560_403_867 145
106 3300049583 Ga0501067_0005419 Ga0501067_0005419_33_500 145
107 3300049583 Ga0501067_0455626 Ga0501067_0455626_62_529 145
108 3300049584 Ga0501068_0345758 Ga0501068_0345758_305_790 145
109 3300049585 Ga0501069_0054849 Ga0501069_0054849_724_1206 145
110 3300049589 Ga0501073_0010323 Ga0501073_0010323_940_1407 145
111 3300049592 Ga0501076_0130518 Ga0501076_0130518_556_1074 145
112 3300049744 Ga0501083_0010298 Ga0501083_0010298_3060_3524 145
113 3300050493 nmdc:mga0k408_410880_c1 nmdc:mga0k408_410880_c1_63_545 145
114 3300050511 nmdc:mga08y16_1100995_c1 nmdc:mga08y16_1100995_c1_105_572 145
115 3300050511 nmdc:mga08y16_40552_c1 nmdc:mga08y16_40552_c1_2070_2567 145
116 3300053077 Ga0495601_0130116 Ga0495601_0130116_1013_1480 145
117 3300053084 Ga0495595_0082355 Ga0495595_0082355_507_986 145
118 3300054114 Ga0501084_0002328 Ga0501084_0002328_125_586 145
119 3300054114 Ga0501084_0011590 Ga0501084_0011590_6724_7188 145
120 3300054114 Ga0501084_0021531 Ga0501084_0021531_3052_3510 145
121 3300054114 Ga0501084_0025284 Ga0501084_0025284_4004_4522 145
122 3300060353 Ga0501082_0043906 Ga0501082_0043906_3095_3553 145
123 3300002067 JGI24735J21928_10100772 JGI24735J21928_101007721 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

115

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cb9-assembly1.cif.gz_A crystal structure of c-as lyase with mercaptoethonal 0.8931 1 116
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.8855 1 117
6xck-assembly3.cif.gz_B crystal structure of c-as lyase with mutation k105e 0.8822 1 116
5d4f-assembly1.cif.gz_A crystal structure of c-as lyase with fe(iii) 0.8806 1 116
5hcw-assembly5.cif.gz_A crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.8761 1 116
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8634 5 50 3.30.720.120
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8607 1 118 3.10.180.10
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8537 1 118 3.10.180.10
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8246 5 49 3.30.720.120
2b94A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.7667 62 116 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A3N4T8U0-F1-model_v4 deleted 0.9443 2 52
AF-A0A7V3VYZ0-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9292 3 62 GO:0046686
GO:0051213
AF-A0A4Q3NYQ8-F1-model_v4 deleted 0.9284 1 53
AF-A0A661A0K5-F1-model_v4 VOC domain-containing protein 0.9189 3 84 GO:0003677
GO:0006352
GO:0016987
GO:0046686
AF-A0A238DPD1-F1-model_v4 deleted 0.9093 5 56

Feature Viewer

pLDDT pTM Quality
74.18 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map