F115353

General Info

Members Datasets Scaffolds Average Seq Length
122 88 116 263

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0709563|Ga0451853_0709563_234_1100
Length 288
Sequence LRFFAVETTIMQDLKITLLQSDLHWEDIEANLAMFEEKIWQVGTTTDVIVLPEMFTTGFTMAASKLAEHMNMRTTKWMKQMADQTGALILGSFVCTVHERYYNRLVWMEPGGNFKTYDKRHLFRMSQEHKTYAQGESLLVGTWKGWRICPLICYDLRFPVWSRNRWDAATKRLNYDLMIYVANWPTIRMQAWDTLLRARAIENLSYVVGVNRIGIDGHDIEYSGHSSVIGPKGDAIFTNEGDEISRTIELSAHALQSFRDRFPAFIDADDFNIEFEAVEESDHMADMG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
4 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
5 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
6 2952252522 Salinicola sp. DM10 Isolate Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
55 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
70 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
71 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
72 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
73 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
76 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
77 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
78 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
79 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
80 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
81 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
82 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
83 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
84 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
85 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
88 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.26
Metatranscriptomes 0.82
Isolates 4.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.11
Nodule 0
Rhizoplane 1.64
Rhizosphere 67.21
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1282688 2162886007 Bacteria 3723
2 rootH1_10055805 3300003316 Bacteria 10718
3 rootH1_10091652 3300003316 Bacteria 2397
4 rootH2_10102172 3300003320 Bacteria 1403
5 rootL2_10002503 3300003322 Bacteria 22876
6 rootL2_10002505 3300003322 Bacteria 6222
7 rootL2_10061974 3300003322 Bacteria 10075
8 rootH1_10000747 3300003323 Bacteria 29495
9 rootH1_10069901 3300003323 Bacteria 2391
10 rootH1_10073882 3300003323 Bacteria 15559
11 rootH1_10075295 3300003323 Bacteria 15921
12 rootH1_10160334 3300003323 Bacteria 3005
13 Ga0065165_1000470 3300005262 Bacteria 62866
14 Ga0065714_10073476 3300005288 Bacteria 3180
15 Ga0065714_10074394 3300005288 Bacteria 3041
16 Ga0065714_10074463 3300005288 Bacteria 3034
17 Ga0065714_10162346 3300005288 Unclassified 1045
18 Ga0065704_10076323 3300005289 Bacteria 5164
19 Ga0065715_10092958 3300005293 Bacteria 4861
20 Ga0065715_10166782 3300005293 Bacteria 1580
21 Ga0070693_100175885 3300005547 Unclassified 1374
22 Ga0068857_100158173 3300005577 Bacteria 2055
23 Ga0068856_100055767 3300005614 Bacteria 3900
24 Ga0068859_100366856 3300005617 Unclassified 1535
25 Ga0068863_100346402 3300005841 Bacteria 1446
26 Ga0075430_100259199 3300006846 Bacteria 1440
27 Ga0075433_10081616 3300006852 Unclassified 2851
28 Ga0075434_100015652 3300006871 Bacteria 7279
29 Ga0097620_100366828 3300006931 Unclassified 1535
30 Ga0111539_10021672 3300009094 Bacteria 7904
31 Ga0111539_10025827 3300009094 Bacteria 7192
32 Ga0111539_10316409 3300009094 Bacteria 1816
33 Ga0114129_10447457 3300009147 Unclassified 1695
34 Ga0105249_10308918 3300009553 Unclassified 1589
35 Ga0157370_10003196 3300013104 Bacteria 19379
36 Ga0157370_10007278 3300013104 Bacteria 12079
37 Ga0157370_10009532 3300013104 Bacteria 10357
38 Ga0157370_10031454 3300013104 Bacteria 5190
39 Ga0157370_10066971 3300013104 Bacteria 3395
40 Ga0163162_10033308 3300013306 Bacteria 5119
41 Ga0182006_1008467 3300015261 Bacteria 4660
42 Ga0209050_1006358 3300025298 Bacteria 7021
43 Ga0207641_10333450 3300026088 Bacteria 1442
44 Ga0207676_10448069 3300026095 Bacteria 1216
45 Ga0207674_10363913 3300026116 Unclassified 1398
46 Ga0209995_1005092 3300027471 Bacteria 2110
47 Ga0209968_1007956 3300027526 Bacteria 1610
48 Ga0210002_1026926 3300027617 Bacteria 945
49 Ga0207428_10071332 3300027907 Unclassified 2728
50 Ga0207428_10103855 3300027907 Bacteria 2193
51 Ga0307515_10000411 3300028794 Bacteria 103597
52 Ga0307515_10158243 3300028794 Bacteria 2326
53 Ga0265327_10000006 3300031251 Bacteria 693716
54 Ga0307513_10281076 3300031456 Bacteria 1442
55 Ga0307513_10305418 3300031456 Bacteria 1356
56 Ga0307408_100013380 3300031548 Bacteria 5445
57 Ga0307405_10000001 3300031731 Bacteria 1731270
58 Ga0307405_10060517 3300031731 Bacteria 2390
59 Ga0307410_10000058 3300031852 Bacteria 39706
60 Ga0307406_10004985 3300031901 Bacteria 7232
61 Ga0307412_10123654 3300031911 Bacteria 1867
62 Ga0307409_100210547 3300031995 Bacteria 1747
63 Ga0307416_100004379 3300032002 Bacteria 8503
64 Ga0307416_100921340 3300032002 Bacteria 975
65 Ga0307414_10001764 3300032004 Bacteria 11216
66 Ga0307414_10192937 3300032004 Unclassified 1650
67 Ga0307411_10025262 3300032005 Bacteria 3557
68 Ga0307415_100023764 3300032126 Bacteria 3813
69 Ga0373927_0002462 3300035695 Bacteria 13509
70 Ga0400483_001336 3300039062 Unclassified 3501
71 Ga0400489_78093 3300039093 Unclassified 2638
72 Ga0439466_0008815 3300041411 Bacteria 3793
73 Ga0451807_1571508 3300041486 Unclassified 1039
74 Ga0451853_0709563 3300041512 Bacteria 1147
75 Ga0451577_0120456 3300042876 Bacteria 2350
76 Ga0453683_0088462 3300044673 Bacteria 1941
77 Ga0453684_0003902 3300044712 Bacteria 32760
78 Ga0451576_0003292 3300045051 Bacteria 22426
79 Ga0451576_0013394 3300045051 Bacteria 9176
80 Ga0451576_0064077 3300045051 Bacteria 3829
81 Ga0451576_0216248 3300045051 Bacteria 2001
82 Ga0466967_0230618 3300045976 Bacteria 1763
83 Ga0495638_0000004 3300046460 Bacteria 700795
84 Ga0495606_0026808 3300046507 Bacteria 4099
85 Ga0495610_0022236 3300046512 Bacteria 3473
86 Ga0495604_0116305 3300047317 Unclassified 1942
87 Ga0496109_0006134 3300048912 Bacteria 10099
88 Ga0496121_0129563 3300048924 Bacteria 1891
89 Ga0501314_000598 3300049530 Bacteria 2288
90 Ga0501202_035013 3300049652 Bacteria 1064
91 Ga0501207_001210 3300049654 Bacteria 3184
92 Ga0501247_002225 3300049677 Bacteria 1997
93 Ga0501257_002520 3300049686 Bacteria 3864
94 Ga0501257_087487 3300049686 Bacteria 808
95 Ga0501280_000793 3300049776 Bacteria 6850
96 nmdc:mga06r32_328501_c1 3300050510 Unclassified 1514
97 nmdc:mga06r32_58713_c1 3300050510 Bacteria 3698
98 nmdc:mga08y16_135068_c1 3300050511 Bacteria 2564
99 nmdc:mga08y16_79290_c1 3300050511 Bacteria 3423
100 nmdc:mga08y16_80326_c1 3300050511 Unclassified 3400
101 nmdc:mga0n895_268079_c1 3300050512 Unclassified 1732
102 nmdc:mga0a205_112318_c1 3300050515 Unclassified 2624
103 Ga0500646_0002544 3300053090 Bacteria 4736
104 Ga0500641_0000012 3300053096 Bacteria 164908
105 Ga0500641_0000077 3300053096 Bacteria 40051
106 Ga0500555_006084 3300053103 Unclassified 3425
107 Ga0500562_011988 3300053108 Bacteria 2201
108 Ga0500594_0040925 3300053118 Bacteria 1267
109 Ga0500652_096318 3300053131 Bacteria 1236
110 Ga0500655_006703 3300053133 Bacteria 2072
111 Ga0500604_0003078 3300053151 Bacteria 4479
112 Ga0500616_0000015 3300053153 Bacteria 633259
113 Ga0500616_0029719 3300053153 Bacteria 3005
114 Ga0500622_0002541 3300053156 Bacteria 13094
115 Ga0500622_0002558 3300053156 Bacteria 13028
116 Ga0500622_0007038 3300053156 Bacteria 6436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_087487 Ga0501257_087487_82_786 214
2 3300005617 Ga0068859_100366856 Ga0068859_1003668562 217
3 3300006931 Ga0097620_100366828 Ga0097620_1003668282 217
4 3300009553 Ga0105249_10308918 Ga0105249_103089181 217
5 3300003323 rootH1_10160334 rootH1_101603343 223
6 3300028794 Ga0307515_10000411 Ga0307515_1000041172 223
7 3300028794 Ga0307515_10158243 Ga0307515_101582433 223
8 3300003316 rootH1_10091652 rootH1_100916522 229
9 3300003320 rootH2_10102172 rootH2_101021721 230
10 3300045976 Ga0466967_0230618 Ga0466967_0230618_716_1477 234
11 3300005547 Ga0070693_100175885 Ga0070693_1001758852 237
12 3300003316 rootH1_10055805 rootH1_100558053 238
13 3300003322 rootL2_10061974 rootL2_1006197410 238
14 3300003323 rootH1_10073882 rootH1_1007388212 238
15 3300003323 rootH1_10075295 rootH1_100752953 238
16 3300005577 Ga0068857_100158173 Ga0068857_1001581733 238
17 3300005614 Ga0068856_100055767 Ga0068856_1000557674 238
18 3300026116 Ga0207674_10363913 Ga0207674_103639132 238
19 3300053153 Ga0500616_0029719 Ga0500616_0029719_1055_1816 248
20 3300009094 Ga0111539_10316409 Ga0111539_103164091 249
21 3300031911 Ga0307412_10123654 Ga0307412_101236542 249
22 3300031995 Ga0307409_100210547 Ga0307409_1002105472 249
23 iso_pu_bacteria 2643221667 2644370450 250
24 iso_pu_bacteria 2904419702 2904421632 250
25 iso_pu_bacteria 2911138879 2911139433 250
26 iso_pu_bacteria 2919509842 2919513138 250
27 iso_pu_bacteria 8057160832 8057161783 250
28 3300006852 Ga0075433_10081616 Ga0075433_100816164 252
29 3300006871 Ga0075434_100015652 Ga0075434_1000156523 252
30 3300009094 Ga0111539_10025827 Ga0111539_100258272 252
31 3300048912 Ga0496109_0006134 Ga0496109_0006134_1676_2461 252
32 3300050510 nmdc:mga06r32_58713_c1 nmdc:mga06r32_58713_c1_1890_2669 252
33 3300050511 nmdc:mga08y16_79290_c1 nmdc:mga08y16_79290_c1_563_1348 252
34 3300050512 nmdc:mga0n895_268079_c1 nmdc:mga0n895_268079_c1_660_1439 252
35 3300050515 nmdc:mga0a205_112318_c1 nmdc:mga0a205_112318_c1_816_1595 252
36 3300053103 Ga0500555_006084 Ga0500555_006084_342_1127 252
37 3300005288 Ga0065714_10162346 Ga0065714_101623462 253
38 3300032004 Ga0307414_10001764 Ga0307414_100017645 253
39 3300041486 Ga0451807_1571508 Ga0451807_1571508_193_1008 253
40 3300049530 Ga0501314_000598 Ga0501314_000598_694_1458 253
41 iso_pu_bacteria 2952252522 2952252960 253
42 2162886007 SwRhRL2b_contig_1282688 SwRhRL2b_0429.00006320 254
43 3300003322 rootL2_10002503 rootL2_100025037 254
44 3300003322 rootL2_10002505 rootL2_100025055 254
45 3300003323 rootH1_10000747 rootH1_100007477 254
46 3300003323 rootH1_10069901 rootH1_100699013 254
47 3300005262 Ga0065165_1000470 Ga0065165_10004704 254
48 3300005288 Ga0065714_10073476 Ga0065714_100734762 254
49 3300005288 Ga0065714_10074394 Ga0065714_100743941 254
50 3300005288 Ga0065714_10074463 Ga0065714_100744633 254
51 3300005289 Ga0065704_10076323 Ga0065704_100763233 254
52 3300005293 Ga0065715_10092958 Ga0065715_100929583 254
53 3300005293 Ga0065715_10166782 Ga0065715_101667822 254
54 3300005841 Ga0068863_100346402 Ga0068863_1003464022 254
55 3300006846 Ga0075430_100259199 Ga0075430_1002591992 254
56 3300009094 Ga0111539_10021672 Ga0111539_100216722 254
57 3300009147 Ga0114129_10447457 Ga0114129_104474572 254
58 3300013104 Ga0157370_10003196 Ga0157370_1000319615 254
59 3300013104 Ga0157370_10007278 Ga0157370_100072785 254
60 3300013104 Ga0157370_10009532 Ga0157370_100095328 254
61 3300013104 Ga0157370_10031454 Ga0157370_100314542 254
62 3300013104 Ga0157370_10066971 Ga0157370_100669713 254
63 3300013306 Ga0163162_10033308 Ga0163162_100333082 254
64 3300015261 Ga0182006_1008467 Ga0182006_10084672 254
65 3300025298 Ga0209050_1006358 Ga0209050_10063583 254
66 3300026088 Ga0207641_10333450 Ga0207641_103334502 254
67 3300026095 Ga0207676_10448069 Ga0207676_104480692 254
68 3300027471 Ga0209995_1005092 Ga0209995_10050922 254
69 3300027526 Ga0209968_1007956 Ga0209968_10079563 254
70 3300027617 Ga0210002_1026926 Ga0210002_10269262 254
71 3300027907 Ga0207428_10071332 Ga0207428_100713322 254
72 3300027907 Ga0207428_10103855 Ga0207428_101038552 254
73 3300031251 Ga0265327_10000006 Ga0265327_10000006173 254
74 3300031456 Ga0307513_10281076 Ga0307513_102810762 254
75 3300031456 Ga0307513_10305418 Ga0307513_103054182 254
76 3300031548 Ga0307408_100013380 Ga0307408_1000133803 254
77 3300031731 Ga0307405_10000001 Ga0307405_10000001337 254
78 3300031731 Ga0307405_10060517 Ga0307405_100605172 254
79 3300031852 Ga0307410_10000058 Ga0307410_1000005842 254
80 3300031901 Ga0307406_10004985 Ga0307406_100049853 254
81 3300032002 Ga0307416_100004379 Ga0307416_1000043792 254
82 3300032002 Ga0307416_100921340 Ga0307416_1009213402 254
83 3300032004 Ga0307414_10192937 Ga0307414_101929372 254
84 3300032005 Ga0307411_10025262 Ga0307411_100252623 254
85 3300032126 Ga0307415_100023764 Ga0307415_1000237643 254
86 3300035695 Ga0373927_0002462 Ga0373927_0002462_2076_2912 254
87 3300039062 Ga0400483_001336 Ga0400483_001336_1710_2501 254
88 3300039093 Ga0400489_78093 Ga0400489_78093_801_1574 254
89 3300041411 Ga0439466_0008815 Ga0439466_0008815_957_1724 254
90 3300041512 Ga0451853_0709563 Ga0451853_0709563_234_1100 254
91 3300042876 Ga0451577_0120456 Ga0451577_0120456_966_1802 254
92 3300044673 Ga0453683_0088462 Ga0453683_0088462_980_1816 254
93 3300044712 Ga0453684_0003902 Ga0453684_0003902_15217_16053 254
94 3300045051 Ga0451576_0003292 Ga0451576_0003292_8229_9065 254
95 3300045051 Ga0451576_0013394 Ga0451576_0013394_5175_6011 254
96 3300045051 Ga0451576_0064077 Ga0451576_0064077_829_1626 254
97 3300045051 Ga0451576_0216248 Ga0451576_0216248_955_1788 254
98 3300046460 Ga0495638_0000004 Ga0495638_0000004_645132_645962 254
99 3300046507 Ga0495606_0026808 Ga0495606_0026808_1712_2476 254
100 3300046512 Ga0495610_0022236 Ga0495610_0022236_162_929 254
101 3300047317 Ga0495604_0116305 Ga0495604_0116305_326_1162 254
102 3300048924 Ga0496121_0129563 Ga0496121_0129563_665_1429 254
103 3300049652 Ga0501202_035013 Ga0501202_035013_231_1052 254
104 3300049654 Ga0501207_001210 Ga0501207_001210_2165_2986 254
105 3300049677 Ga0501247_002225 Ga0501247_002225_218_1039 254
106 3300049686 Ga0501257_002520 Ga0501257_002520_2813_3634 254
107 3300049776 Ga0501280_000793 Ga0501280_000793_1189_1956 254
108 3300050510 nmdc:mga06r32_328501_c1 nmdc:mga06r32_328501_c1_307_1143 254
109 3300050511 nmdc:mga08y16_135068_c1 nmdc:mga08y16_135068_c1_416_1252 254
110 3300050511 nmdc:mga08y16_80326_c1 nmdc:mga08y16_80326_c1_1341_2177 254
111 3300053090 Ga0500646_0002544 Ga0500646_0002544_2598_3365 254
112 3300053096 Ga0500641_0000012 Ga0500641_0000012_42027_42794 254
113 3300053096 Ga0500641_0000077 Ga0500641_0000077_17744_18511 254
114 3300053108 Ga0500562_011988 Ga0500562_011988_614_1438 254
115 3300053118 Ga0500594_0040925 Ga0500594_0040925_428_1195 254
116 3300053131 Ga0500652_096318 Ga0500652_096318_107_937 254
117 3300053133 Ga0500655_006703 Ga0500655_006703_843_1667 254
118 3300053151 Ga0500604_0003078 Ga0500604_0003078_1127_1951 254
119 3300053153 Ga0500616_0000015 Ga0500616_0000015_184720_185550 254
120 3300053156 Ga0500622_0002541 Ga0500622_0002541_12199_13023 254
121 3300053156 Ga0500622_0002558 Ga0500622_0002558_11_835 254
122 3300053156 Ga0500622_0007038 Ga0500622_0007038_3175_4023 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

15

259

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.9748 1 254
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.971 1 254
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9601 1 249
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9381 1 249
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.925 2 249
ID Description Score Start End Superfamily
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9748 1 254 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9741 1 254 3.60.110.10
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.971 1 254 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9606 1 249 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9527 2 249 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A7Y5BAS7-F1-model_v4 Nitrilase family protein 0.9922 1 254 GO:0050152
GO:0106008
AF-A0A7W1G0D3-F1-model_v4 Amidohydrolase 0.9917 1 213 GO:0050152
GO:0106008
AF-A0A6L4Z9Y6-F1-model_v4 CN hydrolase domain-containing protein 0.9913 1 254 GO:0050152
GO:0106008
AF-A0A840EMI5-F1-model_v4 Putative amidohydrolase 0.9905 1 254 GO:0050152
GO:0106008
AF-A0A7Y4WLM3-F1-model_v4 Amidohydrolase 0.9899 1 254 GO:0050152
GO:0106008

Feature Viewer

pLDDT pTM Quality
95.4 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map