F114724

General Info

Members Datasets Scaffolds Average Seq Length
122 77 122 325

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1011009|Ga0265319_10110094
Length 389
Sequence MLPKVGKRFYVKLLTQGSKAGDARRRLFHWQNFCYTIFVALQWTLRAPSTILLNRIISLNQMKNTDKKILLSGVKPTGRPHIGNYFGAMKQFVDFQNDYNSFIFIADYHALNSIQNAQELSRNIMDVAIDYLAIGLNPDTVTFYKQSDVPEHTELAWIFNTITTMPYLMRAHAFKDAEAKNKEISVGTFDYPMLMAADILLYDADVVPVGQDQKQHVEIARDTALKFNRIYGDTFKPPQEMILENVKIVPGTDGRKMSKSYGNTIPLFADDETIKKAVMSIPTDSKSVSEPKNPEEDKVFALHKLFAVPAELSKIREAYEKGGMSYKESKEILIKNISAFIAPMREKRAKIAENESAIIEMLRAGGKRARMIAETKMDLVRKRIGATFS

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
37 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
38 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
39 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
40 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
41 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
42 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
47 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
48 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
61 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
62 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
72 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
73 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
74 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
75 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
76 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
77 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 0
Rhizosphere 98.36
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10011257 3300003373 Bacteria 2285
2 JGI25407J50210_10040400 3300003373 Bacteria 1196
3 Ga0070658_10008148 3300005327 Bacteria 8427
4 Ga0070701_10074396 3300005438 Bacteria 1824
5 Ga0070711_100000017 3300005439 Bacteria 151786
6 Ga0070679_100041943 3300005530 Bacteria 4556
7 Ga0070679_100262628 3300005530 Bacteria 1682
8 Ga0068853_100000005 3300005539 Bacteria 366404
9 Ga0068853_100096876 3300005539 Bacteria 2603
10 Ga0070686_100000037 3300005544 Bacteria 105422
11 Ga0070686_100043639 3300005544 Bacteria 2814
12 Ga0070704_100000001 3300005549 Bacteria 193214
13 Ga0068857_100129813 3300005577 Bacteria 2273
14 Ga0068856_100063005 3300005614 Bacteria 3663
15 Ga0068864_100099677 3300005618 Bacteria 2574
16 Ga0081455_10002573 3300005937 Bacteria 21513
17 Ga0081538_10001460 3300005981 Bacteria 24256
18 Ga0081538_10008009 3300005981 Bacteria 9037
19 Ga0081538_10072991 3300005981 Bacteria 1878
20 Ga0081538_10074565 3300005981 Bacteria 1846
21 Ga0075428_100050360 3300006844 Bacteria 4568
22 Ga0075430_100165643 3300006846 Bacteria 1839
23 Ga0075431_100242354 3300006847 Bacteria 1834
24 Ga0114129_10225545 3300009147 Bacteria 2526
25 Ga0105238_10000091 3300009551 Bacteria 102300
26 Ga0105238_10001364 3300009551 Bacteria 24505
27 Ga0163163_10061062 3300014325 Bacteria 3734
28 Ga0213873_10003319 3300021358 Bacteria 2885
29 Ga0213872_10115892 3300021361 Bacteria 1187
30 Ga0207663_10000002 3300025916 Bacteria 534155
31 Ga0207652_10019828 3300025921 Bacteria 5535
32 Ga0207652_10020858 3300025921 Bacteria 5401
33 Ga0207652_10318839 3300025921 Bacteria 1403
34 Ga0207694_10001421 3300025924 Bacteria 20516
35 Ga0207694_10002186 3300025924 Bacteria 16067
36 Ga0207658_10247221 3300025986 Bacteria 1514
37 Ga0207639_10000010 3300026041 Bacteria 415264
38 Ga0207702_10044753 3300026078 Bacteria 3721
39 Ga0207676_10153643 3300026095 Bacteria 1985
40 Ga0207674_10058589 3300026116 Bacteria 3901
41 Ga0265319_1011009 3300028563 Bacteria 3739
42 Ga0265336_10000045 3300028666 Bacteria 131872
43 Ga0265336_10017572 3300028666 Bacteria 2328
44 Ga0265338_10000002 3300028800 Bacteria 856588
45 Ga0265338_10001955 3300028800 Bacteria 32151
46 Ga0265338_10057024 3300028800 Bacteria 3459
47 Ga0265338_10060674 3300028800 Bacteria 3320
48 Ga0307511_10011521 3300030521 Bacteria 8712
49 Ga0265327_10000625 3300031251 Bacteria 58124
50 Ga0265327_10003914 3300031251 Bacteria 13672
51 Ga0265327_10036931 3300031251 Bacteria 2680
52 Ga0265316_10004101 3300031344 Bacteria 14593
53 Ga0265316_10124418 3300031344 Bacteria 1946
54 Ga0265316_10230600 3300031344 Bacteria 1364
55 Ga0265313_10001246 3300031595 Bacteria 24276
56 Ga0265313_10044187 3300031595 Bacteria 2176
57 Ga0265342_10146347 3300031712 Bacteria 1315
58 Ga0265342_10174060 3300031712 Bacteria 1182
59 Ga0373937_0002857 3300036401 Bacteria 14431
60 Ga0436360_0049342 3300039438 Bacteria 3122
61 Ga0436361_0339025 3300039447 Bacteria 1686
62 Ga0436361_0344960 3300039447 Bacteria 3452
63 Ga0436362_0272930 3300039453 Bacteria 5089
64 Ga0439465_0001338 3300041413 Bacteria 7919
65 Ga0451577_0000052 3300042876 Bacteria 291030
66 Ga0451577_0172108 3300042876 Bacteria 1951
67 Ga0466972_0012393 3300044658 Bacteria 4284
68 Ga0453684_0000030 3300044712 Bacteria 752725
69 Ga0453684_0001145 3300044712 Bacteria 82783
70 Ga0453684_0026714 3300044712 Bacteria 8322
71 Ga0453684_0048410 3300044712 Bacteria 5623
72 Ga0451576_0000062 3300045051 Bacteria 284262
73 Ga0451576_0079484 3300045051 Bacteria 3412
74 Ga0451576_0275160 3300045051 Bacteria 1760
75 Ga0495669_0024996 3300046684 Bacteria 2603
76 Ga0501031_0000120 3300049568 Bacteria 42915
77 Ga0501032_0000929 3300049569 Bacteria 23696
78 Ga0501032_0003726 3300049569 Bacteria 11558
79 Ga0501032_0011912 3300049569 Bacteria 6230
80 Ga0501032_0021526 3300049569 Bacteria 4481
81 Ga0501033_0000004 3300049570 Bacteria 441310
82 Ga0501034_0000216 3300049571 Bacteria 109908
83 Ga0501034_0005668 3300049571 Bacteria 13588
84 Ga0501034_0106353 3300049571 Bacteria 2799
85 Ga0501034_0200625 3300049571 Bacteria 1953
86 Ga0501036_0001634 3300049572 Bacteria 17368
87 Ga0501037_0000758 3300049573 Bacteria 24324
88 Ga0501038_0013364 3300049574 Bacteria 7484
89 Ga0501038_0079321 3300049574 Bacteria 2768
90 Ga0501038_0277393 3300049574 Bacteria 1320
91 Ga0501039_0002502 3300049575 Bacteria 13686
92 Ga0501043_0000650 3300049579 Bacteria 30653
93 Ga0501043_0022363 3300049579 Bacteria 4960
94 Ga0501043_0071186 3300049579 Bacteria 2732
95 Ga0501046_0003621 3300049580 Bacteria 14150
96 Ga0501047_0000561 3300049581 Bacteria 39896
97 Ga0501047_0001506 3300049581 Bacteria 22718
98 Ga0501047_0263680 3300049581 Bacteria 1570
99 Ga0501048_0031734 3300049582 Bacteria 3821
100 Ga0501067_0000605 3300049583 Bacteria 19295
101 Ga0501068_0000044 3300049584 Bacteria 47748
102 Ga0501072_0000037 3300049588 Bacteria 115310
103 Ga0501073_0022939 3300049589 Bacteria 4488
104 Ga0501074_0000303 3300049590 Bacteria 28382
105 Ga0501077_0042810 3300049593 Bacteria 2878
106 Ga0501079_0011495 3300049741 Bacteria 6756
107 Ga0501080_0003874 3300049742 Bacteria 13235
108 Ga0501080_0022764 3300049742 Bacteria 5804
109 Ga0501080_0197158 3300049742 Bacteria 1849
110 Ga0501083_0013090 3300049744 Bacteria 5796
111 Ga0501083_0013388 3300049744 Bacteria 5734
112 Ga0501035_0002099 3300049822 Bacteria 19816
113 Ga0501044_0000500 3300049823 Bacteria 47679
114 Ga0501044_0060715 3300049823 Bacteria 3869
115 Ga0501045_0000279 3300049824 Bacteria 29797
116 nmdc:mga05p37_49751_c1 3300050507 Bacteria 5156
117 Ga0500556_0044787 3300053104 Bacteria 1576
118 Ga0501084_0000068 3300054114 Bacteria 78853
119 Ga0501084_0003613 3300054114 Bacteria 12559
120 Ga0590071_019007 3300059421 Bacteria 1617
121 Ga0501082_0000641 3300060353 Bacteria 30911
122 Ga0530510_0033043 3300061734 Bacteria 3724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10000091 Ga0105238_1000009115 253
2 3300049742 Ga0501080_0197158 Ga0501080_0197158_12_830 262
3 3300049569 Ga0501032_0021526 Ga0501032_0021526_232_1251 296
4 3300049574 Ga0501038_0013364 Ga0501038_0013364_3316_4335 296
5 3300049579 Ga0501043_0022363 Ga0501043_0022363_1120_2139 296
6 3300049581 Ga0501047_0000561 Ga0501047_0000561_10734_11753 296
7 3300049583 Ga0501067_0000605 Ga0501067_0000605_4828_5847 296
8 3300049584 Ga0501068_0000044 Ga0501068_0000044_33639_34658 296
9 3300049588 Ga0501072_0000037 Ga0501072_0000037_29145_30164 296
10 3300049593 Ga0501077_0042810 Ga0501077_0042810_1317_2336 296
11 3300049741 Ga0501079_0011495 Ga0501079_0011495_1372_2391 296
12 3300049742 Ga0501080_0003874 Ga0501080_0003874_1835_2854 296
13 3300049744 Ga0501083_0013090 Ga0501083_0013090_1213_2232 296
14 3300049823 Ga0501044_0060715 Ga0501044_0060715_1518_2537 296
15 3300054114 Ga0501084_0000068 Ga0501084_0000068_29164_30183 296
16 3300060353 Ga0501082_0000641 Ga0501082_0000641_6414_7433 296
17 3300061734 Ga0530510_0033043 Ga0530510_0033043_1218_2237 296
18 3300005530 Ga0070679_100041943 Ga0070679_1000419436 301
19 3300009551 Ga0105238_10001364 Ga0105238_1000136413 301
20 3300025921 Ga0207652_10020858 Ga0207652_100208588 301
21 3300025924 Ga0207694_10001421 Ga0207694_1000142115 301
22 3300031595 Ga0265313_10044187 Ga0265313_100441872 301
23 3300049581 Ga0501047_0001506 Ga0501047_0001506_20322_21260 301
24 3300005544 Ga0070686_100043639 Ga0070686_1000436392 302
25 3300031712 Ga0265342_10174060 Ga0265342_101740601 302
26 3300049569 Ga0501032_0011912 Ga0501032_0011912_3831_4778 302
27 3300049571 Ga0501034_0106353 Ga0501034_0106353_1799_2746 302
28 3300049580 Ga0501046_0003621 Ga0501046_0003621_11853_12800 302
29 3300028800 Ga0265338_10057024 Ga0265338_100570242 303
30 3300028800 Ga0265338_10060674 Ga0265338_100606743 303
31 3300031251 Ga0265327_10003914 Ga0265327_100039147 303
32 3300031344 Ga0265316_10004101 Ga0265316_100041018 303
33 3300044712 Ga0453684_0001145 Ga0453684_0001145_73638_74588 303
34 3300045051 Ga0451576_0000062 Ga0451576_0000062_254350_255306 303
35 3300049571 Ga0501034_0005668 Ga0501034_0005668_1079_2035 303
36 3300028800 Ga0265338_10000002 Ga0265338_10000002692 304
37 3300042876 Ga0451577_0172108 Ga0451577_0172108_927_1880 304
38 3300044712 Ga0453684_0048410 Ga0453684_0048410_286_1239 304
39 3300049581 Ga0501047_0263680 Ga0501047_0263680_369_1343 304
40 3300049742 Ga0501080_0022764 Ga0501080_0022764_4788_5762 304
41 3300005438 Ga0070701_10074396 Ga0070701_100743962 305
42 3300005549 Ga0070704_100000001 Ga0070704_10000000190 305
43 3300025921 Ga0207652_10019828 Ga0207652_100198282 305
44 3300028666 Ga0265336_10017572 Ga0265336_100175721 305
45 3300031251 Ga0265327_10036931 Ga0265327_100369312 305
46 3300045051 Ga0451576_0079484 Ga0451576_0079484_564_1514 305
47 3300005530 Ga0070679_100262628 Ga0070679_1002626282 307
48 3300025921 Ga0207652_10318839 Ga0207652_103188392 307
49 3300005439 Ga0070711_100000017 Ga0070711_10000001716 308
50 3300025916 Ga0207663_10000002 Ga0207663_10000002173 308
51 3300031344 Ga0265316_10124418 Ga0265316_101244181 309
52 3300049589 Ga0501073_0022939 Ga0501073_0022939_1835_2854 309
53 3300049590 Ga0501074_0000303 Ga0501074_0000303_23067_24086 309
54 3300005618 Ga0068864_100099677 Ga0068864_1000996772 310
55 3300005937 Ga0081455_10002573 Ga0081455_100025735 310
56 3300026095 Ga0207676_10153643 Ga0207676_101536432 310
57 3300030521 Ga0307511_10011521 Ga0307511_100115217 310
58 3300036401 Ga0373937_0002857 Ga0373937_0002857_4882_6039 310
59 3300045051 Ga0451576_0275160 Ga0451576_0275160_74_1093 310
60 3300049744 Ga0501083_0013388 Ga0501083_0013388_4568_5596 310
61 3300054114 Ga0501084_0003613 Ga0501084_0003613_10631_11659 310
62 3300005539 Ga0068853_100000005 Ga0068853_100000005177 311
63 3300005544 Ga0070686_100000037 Ga0070686_10000003732 311
64 3300021358 Ga0213873_10003319 Ga0213873_100033193 311
65 3300025986 Ga0207658_10247221 Ga0207658_102472212 311
66 3300026041 Ga0207639_10000010 Ga0207639_10000010120 311
67 3300031595 Ga0265313_10001246 Ga0265313_1000124624 311
68 3300031712 Ga0265342_10146347 Ga0265342_101463472 311
69 3300039438 Ga0436360_0049342 Ga0436360_0049342_1042_2013 311
70 3300039447 Ga0436361_0344960 Ga0436361_0344960_668_1639 311
71 3300039453 Ga0436362_0272930 Ga0436362_0272930_132_1103 311
72 3300042876 Ga0451577_0000052 Ga0451577_0000052_80285_81259 311
73 3300046684 Ga0495669_0024996 Ga0495669_0024996_227_1195 311
74 3300005327 Ga0070658_10008148 Ga0070658_100081482 312
75 3300005539 Ga0068853_100096876 Ga0068853_1000968763 312
76 3300005614 Ga0068856_100063005 Ga0068856_1000630053 312
77 3300014325 Ga0163163_10061062 Ga0163163_100610622 312
78 3300026078 Ga0207702_10044753 Ga0207702_100447534 312
79 3300028666 Ga0265336_10000045 Ga0265336_1000004510 312
80 3300028800 Ga0265338_10001955 Ga0265338_100019559 312
81 3300053104 Ga0500556_0044787 Ga0500556_0044787_355_1332 312
82 3300005577 Ga0068857_100129813 Ga0068857_1001298132 313
83 3300021361 Ga0213872_10115892 Ga0213872_101158921 313
84 3300025924 Ga0207694_10002186 Ga0207694_1000218617 313
85 3300026116 Ga0207674_10058589 Ga0207674_100585895 313
86 3300028563 Ga0265319_1011009 Ga0265319_10110094 313
87 3300031251 Ga0265327_10000625 Ga0265327_1000062526 313
88 3300031344 Ga0265316_10230600 Ga0265316_102306002 313
89 3300039447 Ga0436361_0339025 Ga0436361_0339025_260_1249 313
90 3300044712 Ga0453684_0000030 Ga0453684_0000030_730998_731990 313
91 3300044712 Ga0453684_0026714 Ga0453684_0026714_4612_5592 313
92 3300049568 Ga0501031_0000120 Ga0501031_0000120_21166_22146 313
93 3300049569 Ga0501032_0000929 Ga0501032_0000929_17255_18235 313
94 3300049569 Ga0501032_0003726 Ga0501032_0003726_1274_2254 313
95 3300049570 Ga0501033_0000004 Ga0501033_0000004_203774_204754 313
96 3300049571 Ga0501034_0000216 Ga0501034_0000216_54964_55944 313
97 3300049571 Ga0501034_0200625 Ga0501034_0200625_364_1344 313
98 3300049572 Ga0501036_0001634 Ga0501036_0001634_1484_2464 313
99 3300049573 Ga0501037_0000758 Ga0501037_0000758_7103_8083 313
100 3300049574 Ga0501038_0079321 Ga0501038_0079321_321_1301 313
101 3300049574 Ga0501038_0277393 Ga0501038_0277393_196_1176 313
102 3300049575 Ga0501039_0002502 Ga0501039_0002502_10683_11663 313
103 3300049579 Ga0501043_0000650 Ga0501043_0000650_6233_7213 313
104 3300049579 Ga0501043_0071186 Ga0501043_0071186_239_1219 313
105 3300049582 Ga0501048_0031734 Ga0501048_0031734_780_1760 313
106 3300049822 Ga0501035_0002099 Ga0501035_0002099_18507_19487 313
107 3300049823 Ga0501044_0000500 Ga0501044_0000500_39953_40933 313
108 3300049824 Ga0501045_0000279 Ga0501045_0000279_6979_7959 313
109 3300003373 JGI25407J50210_10011257 JGI25407J50210_100112572 321
110 3300003373 JGI25407J50210_10040400 JGI25407J50210_100404001 321
111 3300005981 Ga0081538_10001460 Ga0081538_1000146018 321
112 3300005981 Ga0081538_10008009 Ga0081538_1000800910 321
113 3300005981 Ga0081538_10072991 Ga0081538_100729912 321
114 3300005981 Ga0081538_10074565 Ga0081538_100745652 321
115 3300006844 Ga0075428_100050360 Ga0075428_1000503602 321
116 3300006846 Ga0075430_100165643 Ga0075430_1001656432 321
117 3300006847 Ga0075431_100242354 Ga0075431_1002423542 321
118 3300009147 Ga0114129_10225545 Ga0114129_102255451 321
119 3300041413 Ga0439465_0001338 Ga0439465_0001338_4260_5273 321
120 3300044658 Ga0466972_0012393 Ga0466972_0012393_1078_2136 321
121 3300050507 nmdc:mga05p37_49751_c1 nmdc:mga05p37_49751_c1_1902_2882 321
122 3300059421 Ga0590071_019007 Ga0590071_019007_476_1477 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

62

352

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d2r-assembly3.cif.gz_C 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site. 0.9731 2 320
7cms-assembly1.cif.gz_A crystal structure of tryptophanyl-trna synthetase from bacillus stearothermophilus in complex with chuangxinmycin 0.9699 2 320
3fhj-assembly3.cif.gz_F independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9677 2 320
3fhj-assembly1.cif.gz_B independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9675 2 320
6dfu-assembly1.cif.gz_A tryptophan--trna ligase from haemophilus influenzae. 0.9666 2 321
ID Description Score Start End Superfamily
af_Q86A90_233_346_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9695 177 288 1.10.240.10
3n9iB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9684 177 286 1.10.240.10
3fhjF02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9681 177 286 1.10.240.10
2ov4A02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9673 177 286 1.10.240.10
3fhjF02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9589 177 286 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A3N4S6H5-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9858 2 321 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A810L127-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9848 4 321 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A359MS74-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9846 2 150 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A3E2YJ15-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9835 2 321 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-Q82HU1-F1-model_v4 Tryptophan--tRNA ligase 2 (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase 2) (TrpRS 2) 0.983 2 321 GO:0004830
GO:0005524
GO:0005829
GO:0006436

Feature Viewer

pLDDT pTM Quality
92.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map