F111849

General Info

Members Datasets Scaffolds Average Seq Length
121 61 121 184

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0061894|Ga0501075_0061894_823_1542
Length 216
Sequence LGCCKTQANGEEIEKITCRQSDKKQAQGRKSQLNSILELDARLSNQMRVAEKPGALRAIAVVFAHSGDSWFWAIGLIAMWISGNSFWKEWAFVQLGCISLLAAMVLLIKFRVRRQRPVGEWGRIYRNTDPHSFPSGHAARAFLIATIAAGLGPGWLAVALWIWAPLVALARVAMGVHYLSDVLAGALLGILVALIGLQIYPPLLGWLSGAVGFSFW

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
3 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
4 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
5 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
6 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
7 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
8 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
19 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
29 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
30 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
31 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
32 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
51 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
52 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
55 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
56 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
57 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
58 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
59 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
60 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
61 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001145 3300003203 Bacteria 12451
2 Ga0070705_100029657 3300005440 Unclassified 3012
3 Ga0070705_100468742 3300005440 Unclassified 949
4 Ga0070706_100042339 3300005467 Unclassified 4207
5 Ga0070698_100111995 3300005471 Bacteria 2694
6 Ga0070698_100894198 3300005471 Bacteria 833
7 Ga0070698_101416978 3300005471 Unclassified 646
8 Ga0070699_100003808 3300005518 Bacteria 13335
9 Ga0070699_100129642 3300005518 Bacteria 2223
10 Ga0068859_101055640 3300005617 Bacteria 893
11 Ga0068859_101532217 3300005617 Unclassified 736
12 Ga0068861_100345224 3300005719 Unclassified 1304
13 Ga0068862_100072213 3300005844 Bacteria 2981
14 Ga0068862_100099859 3300005844 Bacteria 2538
15 Ga0081539_10000596 3300005985 Bacteria 73813
16 Ga0081539_10013390 3300005985 Bacteria 6183
17 Ga0075427_10000122 3300006194 Bacteria 6910
18 Ga0075431_100017208 3300006847 Bacteria 7345
19 Ga0075429_100036387 3300006880 Unclassified 4281
20 Ga0075429_100068295 3300006880 Bacteria 3093
21 Ga0075429_100131586 3300006880 Bacteria 2189
22 Ga0097620_101055963 3300006931 Bacteria 893
23 Ga0097620_101532219 3300006931 Unclassified 736
24 Ga0111539_10044612 3300009094 Bacteria 5311
25 Ga0114129_10022458 3300009147 Bacteria 8956
26 Ga0114129_10126623 3300009147 Bacteria 3511
27 Ga0105243_10104898 3300009148 Unclassified 2353
28 Ga0105243_10161092 3300009148 Bacteria 1934
29 Ga0105249_10431676 3300009553 Unclassified 1353
30 Ga0105249_10629711 3300009553 Bacteria 1129
31 Ga0157380_10218395 3300014326 Bacteria 1704
32 Ga0207684_10081207 3300025910 Bacteria 2759
33 Ga0207660_10546182 3300025917 Unclassified 942
34 Ga0207646_10046653 3300025922 Unclassified 3887
35 Ga0207709_10244676 3300025935 Bacteria 1307
36 Ga0207712_10269302 3300025961 Unclassified 1385
37 Ga0207674_10083807 3300026116 Bacteria 3187
38 Ga0207675_100054161 3300026118 Bacteria 3742
39 Ga0265334_10029868 3300028573 Bacteria 2184
40 Ga0265318_10026978 3300028577 Bacteria 2260
41 Ga0265322_10028317 3300028654 Bacteria 1601
42 Ga0265336_10058319 3300028666 Bacteria 1159
43 Ga0265320_10019838 3300031240 Bacteria 3663
44 Ga0265320_10055406 3300031240 Unclassified 1908
45 Ga0265331_10085427 3300031250 Bacteria 1462
46 Ga0265327_10006392 3300031251 Bacteria 9438
47 Ga0307408_100501215 3300031548 Bacteria 1063
48 Ga0316576_10597685 3300031727 Bacteria 806
49 Ga0316578_10004249 3300031728 Bacteria 6727
50 Ga0307405_10027739 3300031731 Bacteria 3288
51 Ga0307413_10064655 3300031824 Bacteria 2274
52 Ga0307410_10154664 3300031852 Bacteria 1711
53 Ga0307407_10317212 3300031903 Bacteria 1092
54 Ga0307412_10329245 3300031911 Unclassified 1218
55 Ga0307409_100155318 3300031995 Bacteria 1993
56 Ga0307416_100310823 3300032002 Bacteria 1572
57 Ga0307415_100052017 3300032126 Bacteria 2783
58 Ga0316581_0094096 3300037588 Unclassified 922
59 Ga0451577_0095533 3300042876 Unclassified 2654
60 Ga0451577_0285010 3300042876 Bacteria 1497
61 Ga0451577_0378488 3300042876 Unclassified 1284
62 Ga0451577_1137444 3300042876 Unclassified 698
63 Ga0453683_0000523 3300044673 Bacteria 43101
64 Ga0453683_0006094 3300044673 Bacteria 8306
65 Ga0453683_0020615 3300044673 Unclassified 4212
66 Ga0453683_0060246 3300044673 Bacteria 2373
67 Ga0453683_0062393 3300044673 Bacteria 2330
68 Ga0453683_0063731 3300044673 Bacteria 2304
69 Ga0453683_0064949 3300044673 Bacteria 2281
70 Ga0453683_0216149 3300044673 Bacteria 1218
71 Ga0453683_0593048 3300044673 Unclassified 722
72 Ga0453684_0000023 3300044712 Bacteria 857153
73 Ga0453684_0000074 3300044712 Bacteria 438364
74 Ga0453684_0000157 3300044712 Bacteria 304259
75 Ga0453684_0000305 3300044712 Bacteria 207423
76 Ga0453684_0001229 3300044712 Bacteria 78474
77 Ga0453684_0006715 3300044712 Bacteria 21691
78 Ga0453684_0019940 3300044712 Bacteria 10167
79 Ga0453684_0020383 3300044712 Bacteria 10006
80 Ga0453684_0055942 3300044712 Bacteria 5123
81 Ga0453684_0068083 3300044712 Unclassified 4523
82 Ga0453684_0079769 3300044712 Bacteria 4091
83 Ga0453684_0187343 3300044712 Bacteria 2423
84 Ga0453684_0221851 3300044712 Bacteria 2189
85 Ga0453684_0375192 3300044712 Unclassified 1598
86 Ga0453684_0389559 3300044712 Bacteria 1563
87 Ga0453684_0450572 3300044712 Unclassified 1432
88 Ga0453684_0556726 3300044712 Bacteria 1262
89 Ga0453684_0632629 3300044712 Bacteria 1169
90 Ga0453684_0784056 3300044712 Bacteria 1029
91 Ga0453684_0812256 3300044712 Bacteria 1008
92 Ga0453684_0842913 3300044712 Bacteria 986
93 Ga0451576_0000192 3300045051 Bacteria 154140
94 Ga0451576_0001929 3300045051 Bacteria 33173
95 Ga0451576_0002941 3300045051 Bacteria 24186
96 Ga0451576_0024526 3300045051 Bacteria 6516
97 Ga0451576_0089832 3300045051 Bacteria 3195
98 Ga0451576_0169633 3300045051 Bacteria 2278
99 Ga0501042_0346835 3300049578 Bacteria 1074
100 Ga0501072_0393471 3300049588 Bacteria 1099
101 Ga0501073_0231529 3300049589 Bacteria 1276
102 Ga0501075_0010966 3300049591 Bacteria 6391
103 Ga0501075_0061894 3300049591 Unclassified 2821
104 Ga0501075_0785684 3300049591 Bacteria 725
105 Ga0501075_1167089 3300049591 Unclassified 584
106 Ga0501076_0068472 3300049592 Bacteria 2835
107 Ga0501076_0465605 3300049592 Bacteria 1041
108 Ga0501079_0030109 3300049741 Bacteria 4171
109 Ga0501081_0042322 3300049743 Bacteria 3121
110 Ga0501081_0068947 3300049743 Bacteria 2463
111 Ga0501035_0506530 3300049822 Bacteria 993
112 nmdc:mga05p37_13079_c1 3300050507 Bacteria 9932
113 nmdc:mga05p37_233895_c1 3300050507 Bacteria 2213
114 nmdc:mga05p37_303040_c1 3300050507 Bacteria 1898
115 nmdc:mga09592_113913_c1 3300050508 Unclassified 2321
116 nmdc:mga09592_21927_c1 3300050508 Bacteria 5268
117 nmdc:mga09592_368191_c1 3300050508 Bacteria 1243
118 nmdc:mga09592_457086_c1 3300050508 Unclassified 1101
119 nmdc:mga0qj67_178461_c1 3300050509 Bacteria 1725
120 nmdc:mga06r32_52566_c1 3300050510 Bacteria 3902
121 Ga0501084_0135772 3300054114 Unclassified 2071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0375192 Ga0453684_0375192_1094_1576 156
2 3300044712 Ga0453684_0187343 Ga0453684_0187343_1168_1725 169
3 3300028573 Ga0265334_10029868 Ga0265334_100298682 173
4 3300028577 Ga0265318_10026978 Ga0265318_100269784 173
5 3300031240 Ga0265320_10019838 Ga0265320_100198381 173
6 3300031250 Ga0265331_10085427 Ga0265331_100854272 173
7 3300044712 Ga0453684_0000305 Ga0453684_0000305_80713_81234 173
8 3300005518 Ga0070699_100129642 Ga0070699_1001296421 174
9 3300042876 Ga0451577_0095533 Ga0451577_0095533_186_746 174
10 3300044673 Ga0453683_0000523 Ga0453683_0000523_35577_36119 175
11 3300045051 Ga0451576_0001929 Ga0451576_0001929_15215_15757 175
12 3300031240 Ga0265320_10055406 Ga0265320_100554063 177
13 3300031727 Ga0316576_10597685 Ga0316576_105976852 177
14 3300031728 Ga0316578_10004249 Ga0316578_100042495 177
15 3300037588 Ga0316581_0094096 Ga0316581_0094096_235_798 177
16 3300044712 Ga0453684_0079769 Ga0453684_0079769_2911_3471 177
17 3300045051 Ga0451576_0089832 Ga0451576_0089832_1295_1855 177
18 3300042876 Ga0451577_1137444 Ga0451577_1137444_35_601 181
19 3300044673 Ga0453683_0060246 Ga0453683_0060246_867_1427 181
20 3300044673 Ga0453683_0064949 Ga0453683_0064949_460_1020 181
21 3300044712 Ga0453684_0450572 Ga0453684_0450572_28_594 181
22 3300044712 Ga0453684_0784056 Ga0453684_0784056_62_613 181
23 3300045051 Ga0451576_0169633 Ga0451576_0169633_265_825 181
24 3300005467 Ga0070706_100042339 Ga0070706_1000423393 184
25 3300005617 Ga0068859_101055640 Ga0068859_1010556402 184
26 3300005985 Ga0081539_10013390 Ga0081539_100133907 184
27 3300006880 Ga0075429_100068295 Ga0075429_1000682954 184
28 3300006931 Ga0097620_101055963 Ga0097620_1010559632 184
29 3300025910 Ga0207684_10081207 Ga0207684_100812073 184
30 3300028654 Ga0265322_10028317 Ga0265322_100283172 184
31 3300028666 Ga0265336_10058319 Ga0265336_100583192 184
32 3300031251 Ga0265327_10006392 Ga0265327_100063929 184
33 3300031548 Ga0307408_100501215 Ga0307408_1005012152 184
34 3300031731 Ga0307405_10027739 Ga0307405_100277392 184
35 3300031824 Ga0307413_10064655 Ga0307413_100646553 184
36 3300031852 Ga0307410_10154664 Ga0307410_101546642 184
37 3300031903 Ga0307407_10317212 Ga0307407_103172122 184
38 3300031911 Ga0307412_10329245 Ga0307412_103292452 184
39 3300031995 Ga0307409_100155318 Ga0307409_1001553182 184
40 3300032002 Ga0307416_100310823 Ga0307416_1003108232 184
41 3300032126 Ga0307415_100052017 Ga0307415_1000520172 184
42 3300044673 Ga0453683_0020615 Ga0453683_0020615_3482_4051 184
43 3300044673 Ga0453683_0063731 Ga0453683_0063731_966_1535 184
44 3300044712 Ga0453684_0000074 Ga0453684_0000074_5757_6314 184
45 3300044712 Ga0453684_0812256 Ga0453684_0812256_408_977 184
46 3300049589 Ga0501073_0231529 Ga0501073_0231529_79_636 184
47 3300049591 Ga0501075_0785684 Ga0501075_0785684_126_680 184
48 3300049591 Ga0501075_1167089 Ga0501075_1167089_15_569 184
49 3300049592 Ga0501076_0465605 Ga0501076_0465605_469_1023 184
50 3300049743 Ga0501081_0068947 Ga0501081_0068947_1019_1573 184
51 3300050507 nmdc:mga05p37_233895_c1 nmdc:mga05p37_233895_c1_1265_1819 184
52 3300050508 nmdc:mga09592_457086_c1 nmdc:mga09592_457086_c1_106_660 184
53 3300054114 Ga0501084_0135772 Ga0501084_0135772_154_708 184
54 3300050507 nmdc:mga05p37_13079_c1 nmdc:mga05p37_13079_c1_3018_3578 185
55 3300003203 JGI25406J46586_10001145 JGI25406J46586_100011458 186
56 3300005440 Ga0070705_100029657 Ga0070705_1000296573 186
57 3300005440 Ga0070705_100468742 Ga0070705_1004687422 186
58 3300005471 Ga0070698_100111995 Ga0070698_1001119953 186
59 3300005471 Ga0070698_100894198 Ga0070698_1008941982 186
60 3300005471 Ga0070698_101416978 Ga0070698_1014169781 186
61 3300005518 Ga0070699_100003808 Ga0070699_1000038085 186
62 3300005617 Ga0068859_101532217 Ga0068859_1015322172 186
63 3300005719 Ga0068861_100345224 Ga0068861_1003452242 186
64 3300005844 Ga0068862_100072213 Ga0068862_1000722133 186
65 3300005844 Ga0068862_100099859 Ga0068862_1000998594 186
66 3300005985 Ga0081539_10000596 Ga0081539_1000059658 186
67 3300006194 Ga0075427_10000122 Ga0075427_100001224 186
68 3300006847 Ga0075431_100017208 Ga0075431_1000172084 186
69 3300006880 Ga0075429_100036387 Ga0075429_1000363874 186
70 3300006880 Ga0075429_100131586 Ga0075429_1001315862 186
71 3300006931 Ga0097620_101532219 Ga0097620_1015322192 186
72 3300009094 Ga0111539_10044612 Ga0111539_100446124 186
73 3300009147 Ga0114129_10022458 Ga0114129_100224585 186
74 3300009147 Ga0114129_10126623 Ga0114129_101266234 186
75 3300009148 Ga0105243_10104898 Ga0105243_101048983 186
76 3300009148 Ga0105243_10161092 Ga0105243_101610922 186
77 3300009553 Ga0105249_10431676 Ga0105249_104316762 186
78 3300009553 Ga0105249_10629711 Ga0105249_106297112 186
79 3300014326 Ga0157380_10218395 Ga0157380_102183952 186
80 3300025917 Ga0207660_10546182 Ga0207660_105461822 186
81 3300025922 Ga0207646_10046653 Ga0207646_100466532 186
82 3300025935 Ga0207709_10244676 Ga0207709_102446762 186
83 3300025961 Ga0207712_10269302 Ga0207712_102693022 186
84 3300026116 Ga0207674_10083807 Ga0207674_100838075 186
85 3300026118 Ga0207675_100054161 Ga0207675_1000541614 186
86 3300042876 Ga0451577_0285010 Ga0451577_0285010_676_1236 186
87 3300042876 Ga0451577_0378488 Ga0451577_0378488_83_643 186
88 3300044673 Ga0453683_0006094 Ga0453683_0006094_5453_6013 186
89 3300044673 Ga0453683_0062393 Ga0453683_0062393_1055_1615 186
90 3300044673 Ga0453683_0216149 Ga0453683_0216149_96_656 186
91 3300044673 Ga0453683_0593048 Ga0453683_0593048_107_667 186
92 3300044712 Ga0453684_0000023 Ga0453684_0000023_754914_755474 186
93 3300044712 Ga0453684_0000157 Ga0453684_0000157_3217_3777 186
94 3300044712 Ga0453684_0001229 Ga0453684_0001229_10981_11541 186
95 3300044712 Ga0453684_0006715 Ga0453684_0006715_1291_1851 186
96 3300044712 Ga0453684_0019940 Ga0453684_0019940_2027_2587 186
97 3300044712 Ga0453684_0020383 Ga0453684_0020383_382_942 186
98 3300044712 Ga0453684_0055942 Ga0453684_0055942_265_831 186
99 3300044712 Ga0453684_0068083 Ga0453684_0068083_612_1172 186
100 3300044712 Ga0453684_0221851 Ga0453684_0221851_210_770 186
101 3300044712 Ga0453684_0389559 Ga0453684_0389559_444_1004 186
102 3300044712 Ga0453684_0556726 Ga0453684_0556726_189_749 186
103 3300044712 Ga0453684_0632629 Ga0453684_0632629_525_1085 186
104 3300044712 Ga0453684_0842913 Ga0453684_0842913_91_651 186
105 3300045051 Ga0451576_0000192 Ga0451576_0000192_18928_19503 186
106 3300045051 Ga0451576_0002941 Ga0451576_0002941_14039_14617 186
107 3300045051 Ga0451576_0024526 Ga0451576_0024526_96_656 186
108 3300049578 Ga0501042_0346835 Ga0501042_0346835_174_734 186
109 3300049588 Ga0501072_0393471 Ga0501072_0393471_525_1085 186
110 3300049591 Ga0501075_0010966 Ga0501075_0010966_381_941 186
111 3300049591 Ga0501075_0061894 Ga0501075_0061894_823_1542 186
112 3300049592 Ga0501076_0068472 Ga0501076_0068472_471_1031 186
113 3300049741 Ga0501079_0030109 Ga0501079_0030109_1966_2526 186
114 3300049743 Ga0501081_0042322 Ga0501081_0042322_776_1336 186
115 3300049822 Ga0501035_0506530 Ga0501035_0506530_234_794 186
116 3300050507 nmdc:mga05p37_303040_c1 nmdc:mga05p37_303040_c1_974_1534 186
117 3300050508 nmdc:mga09592_113913_c1 nmdc:mga09592_113913_c1_944_1504 186
118 3300050508 nmdc:mga09592_21927_c1 nmdc:mga09592_21927_c1_4213_4773 186
119 3300050508 nmdc:mga09592_368191_c1 nmdc:mga09592_368191_c1_523_1086 186
120 3300050509 nmdc:mga0qj67_178461_c1 nmdc:mga0qj67_178461_c1_426_989 186
121 3300050510 nmdc:mga06r32_52566_c1 nmdc:mga06r32_52566_c1_467_1027 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14378

PAP2_3

PAP2 superfamily

102

195

0.91

PF01569

PAP2

PAP2 superfamily

90

204

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qyy-assembly1.cif.gz_AAA vanadium-dependent bromoperoxidase from corallina pilulifera in complex with chloride 0.851 103 164
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.8082 9 168
1qhb-assembly1.cif.gz_A vanadium bromoperoxidase from red alga corallina officinalis 0.801 103 168
5lpc-assembly1.cif.gz_A crystal structure of vanadium-dependent haloperoxidase from a. marina 0.769 103 169
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7684 9 168
ID Description Score Start End Superfamily
af_Q4E4I4_1_335_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8871 102 165 1.20.144.10
1qhbF00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.828 103 164 1.10.606.10
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8026 3 165 1.20.144.10
af_Q9V576_127_372_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7982 103 171 1.20.144.10
af_O14495_34_287_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7881 101 167 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A1F8RFZ6-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.8902 1 169 GO:0008610
GO:0016020
GO:0042392
GO:1901137
AF-A0A7C3NE13-F1-model_v4 Phosphatase PAP2 family protein 0.8898 5 169 GO:0008610
GO:0016020
GO:0042392
GO:1901137
AF-A0A2M7CK70-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.8855 1 164 GO:0008610
GO:0016020
GO:0042392
GO:1901137
AF-A0A1F8R2I1-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.881 5 151 GO:0008610
GO:0016020
GO:0042392
GO:1901137
AF-A0A7C5NY75-F1-model_v4 Phosphatase PAP2 family protein 0.8799 1 169 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map