F111165

General Info

Members Datasets Scaffolds Average Seq Length
121 46 242 160

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0034606|Ga0451577_0034606_1298_1864
Length 188
Sequence MPVGKQSFGVSLLDLTALISYSATIYQWRVYMSRPSWDEYFMEITCFVAKRSTCLRRQVGAVIVKDKNILATGYNGAPSGVSHCLDVGCLRAKLQIPSGERHELCRGLHAEQNAIIQAAKHGTTIDGASLYCTTMPCIICSKMIINAGIRRIVFAEGYPDQLAEEMMRESGVSVEHYPAELPTSAEEL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
5 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
6 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
7 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
8 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
9 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
10 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
11 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
12 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
13 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
14 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
15 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
16 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
21 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
22 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
23 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
24 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
25 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
26 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
27 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
28 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
29 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
30 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
31 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
32 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
33 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
34 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
35 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
36 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
39 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
40 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
41 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
42 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
43 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
44 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
45 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
46 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 3.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.65
Rhizosphere 85.12
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0034606 3300042876 Bacteria 4553
2 Ga0065704_10165242 3300005289 Bacteria 1327
3 Ga0065707_10084979 3300005295 Bacteria 6580
4 Ga0265328_10192713 3300031239 Bacteria 773
5 Ga0265339_10266460 3300031249 Bacteria 825
6 Ga0265316_10084412 3300031344 Bacteria 2432
7 Ga0265316_10455842 3300031344 Bacteria 917
8 Ga0265316_10571744 3300031344 Bacteria 803
9 Ga0307509_10528570 3300031507 Unclassified 860
10 Ga0316575_10021080 3300031665 Bacteria 2505
11 Ga0316579_10006404 3300031691 Bacteria 4808
12 Ga0316579_10009422 3300031691 Bacteria 4106
13 Ga0316579_10265977 3300031691 Bacteria 829
14 Ga0316576_10003281 3300031727 Bacteria 9445
15 Ga0316576_10007851 3300031727 Bacteria 6746
16 Ga0316576_10080112 3300031727 Unclassified 2421
17 Ga0316576_10094925 3300031727 Bacteria 2224
18 Ga0316576_10099533 3300031727 Bacteria 2172
19 Ga0316576_10145985 3300031727 Bacteria 1782
20 Ga0316576_10158349 3300031727 Bacteria 1707
21 Ga0316576_10187967 3300031727 Bacteria 1558
22 Ga0316576_10291851 3300031727 Bacteria 1220
23 Ga0316576_10519478 3300031727 Bacteria 875
24 Ga0316578_10003756 3300031728 Bacteria 7020
25 Ga0316578_10121618 3300031728 Bacteria 1569
26 Ga0316578_10162865 3300031728 Bacteria 1344
27 Ga0316578_10584775 3300031728 Unclassified 654
28 Ga0316577_10002748 3300031733 Bacteria 8763
29 Ga0316577_10033231 3300031733 Bacteria 2881
30 Ga0316577_10079146 3300031733 Bacteria 1836
31 Ga0316583_10006029 3300032133 Bacteria 4355
32 Ga0316583_10008521 3300032133 Bacteria 3697
33 Ga0316583_10030268 3300032133 Bacteria 1927
34 Ga0316585_10005779 3300032137 Bacteria 3503
35 Ga0316585_10008424 3300032137 Bacteria 2992
36 Ga0316585_10014057 3300032137 Bacteria 2388
37 Ga0316580_10001672 3300032139 Bacteria 5900
38 Ga0316580_10004972 3300032139 Bacteria 3867
39 Ga0316580_10012266 3300032139 Bacteria 2609
40 Ga0316593_10344110 3300032168 Bacteria 570
41 Ga0316592_1052976 3300033524 Bacteria 907
42 Ga0316588_1040906 3300033528 Bacteria 1108
43 Ga0316596_1133475 3300033541 Unclassified 678
44 Ga0373928_0001162 3300035084 Bacteria 5209
45 Ga0373932_0165526 3300035112 Bacteria 767
46 Ga0316574_0065642 3300035398 Bacteria 2285
47 Ga0316574_0076496 3300035398 Bacteria 2120
48 Ga0316582_0009772 3300036647 Bacteria 5219
49 Ga0316582_0180927 3300036647 Bacteria 1434
50 Ga0316582_0205882 3300036647 Bacteria 1343
51 Ga0316582_0221576 3300036647 Unclassified 1293
52 Ga0316584_0000376 3300036712 Bacteria 22964
53 Ga0316584_0026844 3300036712 Bacteria 4235
54 Ga0316584_0035080 3300036712 Bacteria 3721
55 Ga0316581_0001254 3300037588 Bacteria 5618
56 Ga0400484_34555 3300038725 Bacteria 1332
57 Ga0400490_44964 3300038726 Bacteria 1548
58 Ga0400490_60851 3300038726 Bacteria 1589
59 Ga0400491_23071 3300038727 Bacteria 6936
60 Ga0400485_14718 3300038735 Bacteria 17871
61 Ga0400485_21994 3300038735 Bacteria 5214
62 Ga0400486_05955 3300038742 Bacteria 11182
63 Ga0400486_21551 3300038742 Bacteria 20589
64 Ga0400486_24922 3300038742 Bacteria 18959
65 Ga0400483_071935 3300039062 Bacteria 165886
66 Ga0400483_100156 3300039062 Bacteria 37225
67 Ga0400483_173151 3300039062 Bacteria 20816
68 Ga0400489_25682 3300039093 Bacteria 26714
69 Ga0400487_05930 3300039110 Bacteria 1581
70 Ga0400487_65060 3300039110 Bacteria 2675
71 Ga0451795_1520266 3300041456 Bacteria 1064
72 Ga0451807_1398539 3300041486 Bacteria 516
73 Ga0451577_0000018 3300042876 Bacteria 516495
74 Ga0451577_0000053 3300042876 Bacteria 279563
75 Ga0451577_0001191 3300042876 Bacteria 36479
76 Ga0451577_0015783 3300042876 Bacteria 7010
77 Ga0451577_0120224 3300042876 Bacteria 2353
78 Ga0451577_0262244 3300042876 Bacteria 1565
79 Ga0453683_0000025 3300044673 Bacteria 255308
80 Ga0453683_0000068 3300044673 Bacteria 164042
81 Ga0453683_0000071 3300044673 Bacteria 158207
82 Ga0453683_0000345 3300044673 Bacteria 56377
83 Ga0453683_0000375 3300044673 Bacteria 53450
84 Ga0453683_0128267 3300044673 Bacteria 1598
85 Ga0453683_0259318 3300044673 Bacteria 1109
86 Ga0453684_0000103 3300044712 Bacteria 366458
87 Ga0453684_0000347 3300044712 Bacteria 192636
88 Ga0453684_0000457 3300044712 Bacteria 163653
89 Ga0453684_0002329 3300044712 Bacteria 46512
90 Ga0453684_0007822 3300044712 Bacteria 19488
91 Ga0453684_0012661 3300044712 Bacteria 13865
92 Ga0453684_0012966 3300044712 Bacteria 13638
93 Ga0453684_0013208 3300044712 Bacteria 13463
94 Ga0453684_0014202 3300044712 Bacteria 12784
95 Ga0453684_0015341 3300044712 Bacteria 12135
96 Ga0453684_0021483 3300044712 Bacteria 9640
97 Ga0453684_0033385 3300044712 Bacteria 7177
98 Ga0453684_0063538 3300044712 Bacteria 4722
99 Ga0453684_0072114 3300044712 Bacteria 4362
100 Ga0453684_0106810 3300044712 Bacteria 3410
101 Ga0453684_0132639 3300044712 Bacteria 2987
102 Ga0453684_0219937 3300044712 Bacteria 2201
103 Ga0453684_0432246 3300044712 Bacteria 1468
104 Ga0453684_0502318 3300044712 Bacteria 1342
105 Ga0453684_1189477 3300044712 Unclassified 801
106 Ga0451576_0000241 3300045051 Bacteria 133881
107 Ga0451576_0000746 3300045051 Bacteria 64903
108 Ga0451576_0002378 3300045051 Bacteria 28355
109 Ga0451576_0091019 3300045051 Bacteria 3173
110 Ga0451576_0122134 3300045051 Bacteria 2712
111 Ga0451576_0150761 3300045051 Bacteria 2425
112 Ga0451576_1217288 3300045051 Bacteria 786
113 Ga0451576_2343723 3300045051 Bacteria 547
114 Ga0495653_0271431 3300046463 Bacteria 1117
115 Ga0495628_0035590 3300046516 Bacteria 4000
116 Ga0495599_0225846 3300046678 Bacteria 1144
117 Ga0495624_0016673 3300046690 Bacteria 4945
118 Ga0495674_0013487 3300047319 Bacteria 7685
119 Ga0495684_0076942 3300047471 Bacteria 2534
120 Ga0501081_0162880 3300049743 Bacteria 1608
121 Ga0501082_1419450 3300060353 Bacteria 606
122 Ga0451577_0034606
123 Ga0065704_10165242
124 Ga0065707_10084979
125 Ga0265328_10192713
126 Ga0265339_10266460
127 Ga0265316_10084412
128 Ga0265316_10455842
129 Ga0265316_10571744
130 Ga0307509_10528570
131 Ga0316575_10021080
132 Ga0316579_10006404
133 Ga0316579_10009422
134 Ga0316579_10265977
135 Ga0316576_10003281
136 Ga0316576_10007851
137 Ga0316576_10080112
138 Ga0316576_10094925
139 Ga0316576_10099533
140 Ga0316576_10145985
141 Ga0316576_10158349
142 Ga0316576_10187967
143 Ga0316576_10291851
144 Ga0316576_10519478
145 Ga0316578_10003756
146 Ga0316578_10121618
147 Ga0316578_10162865
148 Ga0316578_10584775
149 Ga0316577_10002748
150 Ga0316577_10033231
151 Ga0316577_10079146
152 Ga0316583_10006029
153 Ga0316583_10008521
154 Ga0316583_10030268
155 Ga0316585_10005779
156 Ga0316585_10008424
157 Ga0316585_10014057
158 Ga0316580_10001672
159 Ga0316580_10004972
160 Ga0316580_10012266
161 Ga0316593_10344110
162 Ga0316592_1052976
163 Ga0316588_1040906
164 Ga0316596_1133475
165 Ga0373928_0001162
166 Ga0373932_0165526
167 Ga0316574_0065642
168 Ga0316574_0076496
169 Ga0316582_0009772
170 Ga0316582_0180927
171 Ga0316582_0205882
172 Ga0316582_0221576
173 Ga0316584_0000376
174 Ga0316584_0026844
175 Ga0316584_0035080
176 Ga0316581_0001254
177 Ga0400484_34555
178 Ga0400490_44964
179 Ga0400490_60851
180 Ga0400491_23071
181 Ga0400485_14718
182 Ga0400485_21994
183 Ga0400486_05955
184 Ga0400486_21551
185 Ga0400486_24922
186 Ga0400483_071935
187 Ga0400483_100156
188 Ga0400483_173151
189 Ga0400489_25682
190 Ga0400487_05930
191 Ga0400487_65060
192 Ga0451795_1520266
193 Ga0451807_1398539
194 Ga0451577_0000018
195 Ga0451577_0000053
196 Ga0451577_0001191
197 Ga0451577_0015783
198 Ga0451577_0120224
199 Ga0451577_0262244
200 Ga0453683_0000025
201 Ga0453683_0000068
202 Ga0453683_0000071
203 Ga0453683_0000345
204 Ga0453683_0000375
205 Ga0453683_0128267
206 Ga0453683_0259318
207 Ga0453684_0000103
208 Ga0453684_0000347
209 Ga0453684_0000457
210 Ga0453684_0002329
211 Ga0453684_0007822
212 Ga0453684_0012661
213 Ga0453684_0012966
214 Ga0453684_0013208
215 Ga0453684_0014202
216 Ga0453684_0015341
217 Ga0453684_0021483
218 Ga0453684_0033385
219 Ga0453684_0063538
220 Ga0453684_0072114
221 Ga0453684_0106810
222 Ga0453684_0132639
223 Ga0453684_0219937
224 Ga0453684_0432246
225 Ga0453684_0502318
226 Ga0453684_1189477
227 Ga0451576_0000241
228 Ga0451576_0000746
229 Ga0451576_0002378
230 Ga0451576_0091019
231 Ga0451576_0122134
232 Ga0451576_0150761
233 Ga0451576_1217288
234 Ga0451576_2343723
235 Ga0495653_0271431
236 Ga0495628_0035590
237 Ga0495599_0225846
238 Ga0495624_0016673
239 Ga0495674_0013487
240 Ga0495684_0076942
241 Ga0501081_0162880
242 Ga0501082_1419450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

35

156

0.97

PF14437

MafB19-deam

MafB19-like deaminase

35

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8976 2 146
2hvv-assembly1.cif.gz_A crystal structure of dcmp deaminase from streptococcus mutans 0.8917 5 150
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8908 2 146
4p9c-assembly1.cif.gz_J crystal structure of dcmp deaminase from the cyanophage s-tim5 in complex with dcmp and dump 0.8887 1 146
4p9c-assembly1.cif.gz_J crystal structure of dcmp deaminase from the cyanophage s-tim5 in complex with dcmp and dump 0.8825 1 146
ID Description Score Start End Superfamily
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8976 2 146 3.40.140.10
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8917 5 150 3.40.140.10
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8908 2 146 3.40.140.10
af_P06773_157_310_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8887 3 150 3.40.140.10
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8622 5 150 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A419GUT1-F1-model_v4 Cytidine deaminase 0.9514 1 146 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A2T2WG96-F1-model_v4 Competence protein ComE 0.9497 2 146 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A848ZBK3-F1-model_v4 Cytidine deaminase 0.9479 2 147 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A7J2J8P6-F1-model_v4 dCMP deaminase family protein 0.9472 2 121 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A7V5BR45-F1-model_v4 dCMP deaminase 0.947 1 146 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972

Map