F110683

General Info

Members Datasets Scaffolds Average Seq Length
121 89 242 297

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10001606|Ga0307511_100016063
Length 311
Sequence LNQPTVIVIVGPTAVGKTAAAIRLALGLQTDIISADSRQCFTELNIGVAKPSPEELRAVHHYFINSHSILQEVNAALFEELALQWTEEIFRKQTCPRHPSVQAGPTAVMVGGTGLYIKAFTEGLDEIPATRPDIREQILAKYESSGLDWLQQEIKSADPAFYEAGEIHNPQRLMRALEVKWSTGRSILSFRRHGKKQRPFRIEKIGLHLPKEQLHQRIXXXVDQMMEQGLLEEVKGLLPYKKENALQTVGYRELFDYLDGISSLDEAIEKIKTNTRHYAKRQMTWFRKDPSIRWIDAGEFLEDPLKKITQS

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
55 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
85 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
86 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
87 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 0.83
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10001606 3300030521 Bacteria 23990
2 rootH1_10055347 3300003323 Bacteria 26133
3 Ga0070658_10131034 3300005327 Unclassified 2090
4 Ga0068869_100019522 3300005334 Bacteria 4634
5 Ga0070682_100022753 3300005337 Bacteria 3716
6 Ga0070661_100032195 3300005344 Bacteria 3794
7 Ga0070673_100007929 3300005364 Bacteria 7040
8 Ga0070701_10042615 3300005438 Bacteria 2318
9 Ga0070663_100341667 3300005455 Bacteria 1210
10 Ga0070684_100108792 3300005535 Unclassified 2484
11 Ga0068853_100057570 3300005539 Bacteria 3355
12 Ga0070686_100041142 3300005544 Unclassified 2887
13 Ga0070664_100037694 3300005564 Bacteria 4066
14 Ga0068857_100151253 3300005577 Unclassified 2103
15 Ga0068857_100345921 3300005577 Bacteria 1376
16 Ga0068856_100010248 3300005614 Bacteria 9110
17 Ga0068852_100003396 3300005616 Bacteria 11122
18 Ga0068852_100490308 3300005616 Bacteria 1222
19 Ga0068859_100000757 3300005617 Bacteria 32578
20 Ga0068862_100431876 3300005844 Bacteria 1238
21 Ga0081540_1008367 3300005983 Bacteria 7230
22 Ga0075366_10027981 3300006195 Bacteria 3307
23 Ga0075366_10123767 3300006195 Bacteria 1559
24 Ga0097621_100085669 3300006237 Bacteria 2628
25 Ga0068871_100217208 3300006358 Bacteria 1655
26 Ga0075428_100032709 3300006844 Bacteria 5744
27 Ga0075430_100056145 3300006846 Bacteria 3310
28 Ga0075429_100022616 3300006880 Bacteria 5450
29 Ga0097620_100000757 3300006931 Bacteria 32578
30 Ga0105240_10000008 3300009093 Bacteria 618862
31 Ga0105240_10163988 3300009093 Bacteria 2637
32 Ga0114129_10014867 3300009147 Bacteria 11089
33 Ga0105241_10011409 3300009174 Bacteria 6514
34 Ga0105241_10066594 3300009174 Bacteria 2786
35 Ga0105237_10000137 3300009545 Bacteria 102639
36 Ga0105237_10013321 3300009545 Bacteria 8625
37 Ga0105237_10057490 3300009545 Bacteria 3892
38 Ga0105237_10124474 3300009545 Bacteria 2573
39 Ga0105237_10278614 3300009545 Bacteria 1675
40 Ga0105239_10004102 3300010375 Bacteria 17516
41 Ga0105239_10004628 3300010375 Bacteria 16354
42 Ga0105239_10017342 3300010375 Bacteria 7965
43 Ga0105239_10020410 3300010375 Bacteria 7309
44 Ga0157373_10026648 3300013100 Bacteria 4173
45 Ga0157370_10071730 3300013104 Bacteria 3268
46 Ga0157370_10430517 3300013104 Bacteria 1213
47 Ga0157369_10030585 3300013105 Bacteria 5938
48 Ga0157374_10078178 3300013296 Bacteria 3133
49 Ga0157374_10149839 3300013296 Bacteria 2267
50 Ga0157374_10301793 3300013296 Bacteria 1584
51 Ga0157378_10005471 3300013297 Bacteria 11128
52 Ga0157372_10119344 3300013307 Bacteria 3027
53 Ga0157372_10128434 3300013307 Bacteria 2915
54 Ga0157372_10466467 3300013307 Bacteria 1472
55 Ga0207705_10266256 3300025909 Unclassified 1310
56 Ga0207654_10022559 3300025911 Bacteria 3360
57 Ga0207695_10000021 3300025913 Bacteria 679399
58 Ga0207695_10000039 3300025913 Bacteria 454801
59 Ga0207695_10006533 3300025913 Bacteria 15095
60 Ga0207671_10000424 3300025914 Bacteria 58429
61 Ga0207671_10056764 3300025914 Bacteria 2901
62 Ga0207671_10077374 3300025914 Bacteria 2490
63 Ga0207671_10081866 3300025914 Bacteria 2421
64 Ga0207652_10322229 3300025921 Unclassified 1395
65 Ga0207689_10094738 3300025942 Bacteria 2452
66 Ga0207679_10018956 3300025945 Bacteria 4617
67 Ga0207667_10002996 3300025949 Bacteria 20967
68 Ga0207667_10004578 3300025949 Bacteria 16953
69 Ga0207639_10082800 3300026041 Bacteria 2545
70 Ga0207702_10014723 3300026078 Bacteria 6488
71 Ga0207674_10073413 3300026116 Unclassified 3435
72 Ga0268265_10102695 3300028380 Bacteria 2313
73 Ga0268265_10410615 3300028380 Bacteria 1254
74 Ga0307513_10028247 3300031456 Bacteria 6417
75 Ga0307513_10364420 3300031456 Bacteria 1189
76 Ga0307509_10031512 3300031507 Bacteria 5854
77 Ga0307508_10272962 3300031616 Unclassified 1285
78 Ga0307510_10000869 3300033180 Bacteria 31741
79 Ga0451802_1521935 3300041460 Bacteria 1389
80 Ga0451843_1604083 3300041509 Bacteria 1425
81 Ga0439449_0028173 3300042007 Bacteria 2094
82 Ga0439457_010925 3300042014 Bacteria 2076
83 Ga0439457_023517 3300042014 Unclassified 1363
84 Ga0450898_011186 3300042134 Bacteria 1465
85 Ga0466969_0000366 3300044656 Bacteria 24782
86 Ga0466972_0000064 3300044658 Bacteria 104558
87 Ga0466972_0000348 3300044658 Bacteria 25310
88 Ga0466972_0077898 3300044658 Bacteria 1579
89 Ga0466966_0001023 3300044684 Bacteria 17865
90 Ga0466968_0024928 3300044735 Bacteria 2446
91 Ga0466968_0039502 3300044735 Bacteria 1987
92 Ga0466957_0000134 3300044842 Bacteria 31410
93 Ga0466957_0008275 3300044842 Bacteria 5912
94 Ga0466959_0000111 3300045049 Bacteria 52637
95 Ga0495638_0037531 3300046460 Bacteria 3082
96 Ga0495606_0022321 3300046507 Bacteria 4613
97 Ga0495611_0000135 3300046648 Bacteria 51495
98 Ga0495672_0055207 3300047320 Bacteria 2319
99 Ga0501034_0244708 3300049571 Bacteria 1739
100 Ga0501046_0030272 3300049580 Bacteria 4394
101 Ga0501047_0005548 3300049581 Bacteria 11874
102 Ga0501069_0023747 3300049585 Bacteria 3342
103 Ga0501070_0076209 3300049586 Bacteria 2776
104 Ga0501071_0068318 3300049587 Bacteria 2586
105 Ga0501225_0001088 3300049705 Bacteria 8531
106 Ga0501079_0095918 3300049741 Unclassified 2299
107 Ga0501083_0015408 3300049744 Bacteria 5353
108 Ga0501044_0019114 3300049823 Bacteria 7335
109 nmdc:mga0k408_82908_c1 3300050493 Bacteria 1879
110 nmdc:mga05p37_10412_c1 3300050507 Bacteria 11036
111 nmdc:mga09592_16706_c1 3300050508 Bacteria 6007
112 Ga0500646_0001881 3300053090 Bacteria 5507
113 Ga0500583_0000031 3300053092 Bacteria 104319
114 Ga0500583_0000923 3300053092 Bacteria 8392
115 Ga0500559_0022204 3300053136 Bacteria 2692
116 Ga0500559_0075582 3300053136 Bacteria 1524
117 Ga0500568_0001675 3300053139 Bacteria 13865
118 Ga0500622_0000432 3300053156 Bacteria 39841
119 Ga0500636_0034813 3300053177 Bacteria 2981
120 Ga0501084_0216859 3300054114 Bacteria 1614
121 2738730515 2738541278 Bacteria 9755573
122 Ga0307511_10001606
123 rootH1_10055347
124 Ga0070658_10131034
125 Ga0068869_100019522
126 Ga0070682_100022753
127 Ga0070661_100032195
128 Ga0070673_100007929
129 Ga0070701_10042615
130 Ga0070663_100341667
131 Ga0070684_100108792
132 Ga0068853_100057570
133 Ga0070686_100041142
134 Ga0070664_100037694
135 Ga0068857_100151253
136 Ga0068857_100345921
137 Ga0068856_100010248
138 Ga0068852_100003396
139 Ga0068852_100490308
140 Ga0068859_100000757
141 Ga0068862_100431876
142 Ga0081540_1008367
143 Ga0075366_10027981
144 Ga0075366_10123767
145 Ga0097621_100085669
146 Ga0068871_100217208
147 Ga0075428_100032709
148 Ga0075430_100056145
149 Ga0075429_100022616
150 Ga0097620_100000757
151 Ga0105240_10000008
152 Ga0105240_10163988
153 Ga0114129_10014867
154 Ga0105241_10011409
155 Ga0105241_10066594
156 Ga0105237_10000137
157 Ga0105237_10013321
158 Ga0105237_10057490
159 Ga0105237_10124474
160 Ga0105237_10278614
161 Ga0105239_10004102
162 Ga0105239_10004628
163 Ga0105239_10017342
164 Ga0105239_10020410
165 Ga0157373_10026648
166 Ga0157370_10071730
167 Ga0157370_10430517
168 Ga0157369_10030585
169 Ga0157374_10078178
170 Ga0157374_10149839
171 Ga0157374_10301793
172 Ga0157378_10005471
173 Ga0157372_10119344
174 Ga0157372_10128434
175 Ga0157372_10466467
176 Ga0207705_10266256
177 Ga0207654_10022559
178 Ga0207695_10000021
179 Ga0207695_10000039
180 Ga0207695_10006533
181 Ga0207671_10000424
182 Ga0207671_10056764
183 Ga0207671_10077374
184 Ga0207671_10081866
185 Ga0207652_10322229
186 Ga0207689_10094738
187 Ga0207679_10018956
188 Ga0207667_10002996
189 Ga0207667_10004578
190 Ga0207639_10082800
191 Ga0207702_10014723
192 Ga0207674_10073413
193 Ga0268265_10102695
194 Ga0268265_10410615
195 Ga0307513_10028247
196 Ga0307513_10364420
197 Ga0307509_10031512
198 Ga0307508_10272962
199 Ga0307510_10000869
200 Ga0451802_1521935
201 Ga0451843_1604083
202 Ga0439449_0028173
203 Ga0439457_010925
204 Ga0439457_023517
205 Ga0450898_011186
206 Ga0466969_0000366
207 Ga0466972_0000064
208 Ga0466972_0000348
209 Ga0466972_0077898
210 Ga0466966_0001023
211 Ga0466968_0024928
212 Ga0466968_0039502
213 Ga0466957_0000134
214 Ga0466957_0008275
215 Ga0466959_0000111
216 Ga0495638_0037531
217 Ga0495606_0022321
218 Ga0495611_0000135
219 Ga0495672_0055207
220 Ga0501034_0244708
221 Ga0501046_0030272
222 Ga0501047_0005548
223 Ga0501069_0023747
224 Ga0501070_0076209
225 Ga0501071_0068318
226 Ga0501225_0001088
227 Ga0501079_0095918
228 Ga0501083_0015408
229 Ga0501044_0019114
230 nmdc:mga0k408_82908_c1
231 nmdc:mga05p37_10412_c1
232 nmdc:mga09592_16706_c1
233 Ga0500646_0001881
234 Ga0500583_0000031
235 Ga0500583_0000923
236 Ga0500559_0022204
237 Ga0500559_0075582
238 Ga0500568_0001675
239 Ga0500622_0000432
240 Ga0500636_0034813
241 Ga0501084_0216859
242 2738730515

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

39

289

0.95

PF01745

IPT

Isopentenyl transferase

4

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9335 3 284
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9088 5 289
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9053 3 284
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8912 5 289
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8425 3 284
ID Description Score Start End Superfamily
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.949 199 276 1.10.287.890
3crrA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9377 201 279 1.10.287.890
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9376 3 113 3.40.50.300
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9372 3 109 3.40.50.300
af_P9WJW1_115_180_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9341 115 178 1.10.20.140
ID Description Score Start End GO Terms
AF-A0A6N9NM87-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.963 2 289 GO:0005524
GO:0006400
GO:0052381
AF-A0A2N2Z766-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.955 3 284 GO:0005524
GO:0006400
GO:0052381
AF-A0A7W4DX40-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9535 3 290 GO:0005524
GO:0006400
GO:0052381
AF-A0A6N9NM87-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9534 2 289 GO:0005524
GO:0006400
GO:0052381
AF-A0A2W2AFC2-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.953 5 288 GO:0005524
GO:0006400
GO:0052381

Map