F110449

General Info

Members Datasets Scaffolds Average Seq Length
121 76 121 305

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10293739|Ga0207665_102937392
Length 336
Sequence MMRTHQARYHLSFSSPRLLIRLLLTGMLVSLPGSAGIRACLYSVNATQQAGTPAIPGKALPEKIDELVRASGAETVAVAYYDLATGKELSINPDVSFHAASTMKVPVMMEIFRQAAAGKLSIDQRIWVKNDFTSIVDGSHYSLTPDSDSDQSLYTKAGQTVTIRELMRLMITVSSNLATNLLIERVTPERVMDLMHTIGAEHIRVLRGVEDGKAFQQGLNNTTTARDLMIILRRIAERRAVSAKASADMIKIMLDQKFNEGIPAGLPQKARVSHKTGSITRINHDAAIVFPSGRKPYVLVVLTRGIEDEKLAHQLIADISRMIYDYAISSSASNGK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
59 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
68 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
70 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
71 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
72 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
73 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
74 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
75 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
76 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.31
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10238924 3300005293 Unclassified 1206
2 Ga0065707_10128780 3300005295 Unclassified 1954
3 Ga0070676_10008521 3300005328 Bacteria 5526
4 Ga0070690_100036753 3300005330 Bacteria 3081
5 Ga0070690_100190282 3300005330 Unclassified 1422
6 Ga0070666_10065860 3300005335 Bacteria 2458
7 Ga0070666_10123744 3300005335 Bacteria 1794
8 Ga0070703_10006633 3300005406 Bacteria 3240
9 Ga0070709_10000094 3300005434 Bacteria 62935
10 Ga0070709_10004355 3300005434 Bacteria 7631
11 Ga0070701_10104475 3300005438 Bacteria 1574
12 Ga0070705_100000081 3300005440 Bacteria 52645
13 Ga0070705_100065206 3300005440 Bacteria 2179
14 Ga0070708_100181873 3300005445 Bacteria 1965
15 Ga0070706_100000202 3300005467 Bacteria 75165
16 Ga0070707_100000138 3300005468 Bacteria 68485
17 Ga0070707_100226004 3300005468 Bacteria 1822
18 Ga0070707_100247435 3300005468 Bacteria 1735
19 Ga0070707_100345864 3300005468 Bacteria 1444
20 Ga0070698_100026068 3300005471 Bacteria 6088
21 Ga0070698_100237638 3300005471 Bacteria 1755
22 Ga0070698_100460890 3300005471 Bacteria 1207
23 Ga0070699_100000013 3300005518 Bacteria 241303
24 Ga0070699_100026143 3300005518 Bacteria 5035
25 Ga0070699_100257585 3300005518 Unclassified 1560
26 Ga0070686_100018650 3300005544 Bacteria 4078
27 Ga0070695_100317293 3300005545 Bacteria 1157
28 Ga0070696_100000142 3300005546 Bacteria 39428
29 Ga0070693_100009017 3300005547 Bacteria 4950
30 Ga0070693_100139706 3300005547 Unclassified 1523
31 Ga0070704_100055371 3300005549 Bacteria 2812
32 Ga0070704_100057379 3300005549 Bacteria 2768
33 Ga0070704_100177861 3300005549 Unclassified 1699
34 Ga0068855_100001511 3300005563 Bacteria 29144
35 Ga0068857_100133785 3300005577 Bacteria 2238
36 Ga0068859_100378551 3300005617 Unclassified 1511
37 Ga0068864_100633010 3300005618 Unclassified 1040
38 Ga0068858_100423417 3300005842 Bacteria 1280
39 Ga0068860_100002100 3300005843 Bacteria 21003
40 Ga0068860_100020530 3300005843 Bacteria 6398
41 Ga0081455_10030229 3300005937 Bacteria 4924
42 Ga0081540_1047951 3300005983 Bacteria 2143
43 Ga0081539_10005403 3300005985 Bacteria 13073
44 Ga0070716_100151832 3300006173 Bacteria 1491
45 Ga0070716_100191969 3300006173 Unclassified 1350
46 Ga0075428_100006830 3300006844 Bacteria 12689
47 Ga0075428_100024517 3300006844 Bacteria 6675
48 Ga0075428_100255291 3300006844 Bacteria 1888
49 Ga0075431_100501140 3300006847 Bacteria 1205
50 Ga0075434_100117463 3300006871 Bacteria 2673
51 Ga0075434_100462727 3300006871 Bacteria 1290
52 Ga0075429_100000495 3300006880 Bacteria 29570
53 Ga0075429_100099421 3300006880 Bacteria 2538
54 Ga0075436_100013258 3300006914 Bacteria 5648
55 Ga0075436_100291269 3300006914 Bacteria 1169
56 Ga0075435_100039613 3300007076 Bacteria 3761
57 Ga0075435_100086831 3300007076 Bacteria 2577
58 Ga0111539_10170607 3300009094 Unclassified 2542
59 Ga0105247_10087783 3300009101 Bacteria 1970
60 Ga0114129_10008651 3300009147 Bacteria 14513
61 Ga0114129_10019033 3300009147 Bacteria 9781
62 Ga0114129_10098393 3300009147 Bacteria 4049
63 Ga0114129_10253877 3300009147 Bacteria 2359
64 Ga0114129_10291654 3300009147 Unclassified 2177
65 Ga0105248_10132747 3300009177 Bacteria 2809
66 Ga0105248_10201126 3300009177 Unclassified 2245
67 Ga0105248_10379567 3300009177 Bacteria 1591
68 Ga0105239_10266829 3300010375 Unclassified 1925
69 Ga0157378_10000110 3300013297 Bacteria 78459
70 Ga0163163_10193065 3300014325 Unclassified 2084
71 Ga0163163_10312622 3300014325 Unclassified 1624
72 Ga0157379_10071842 3300014968 Bacteria 3096
73 Ga0207653_10000071 3300025885 Bacteria 75651
74 Ga0207699_10000008 3300025906 Bacteria 358402
75 Ga0207699_10073607 3300025906 Bacteria 2096
76 Ga0207684_10000204 3300025910 Bacteria 91621
77 Ga0207663_10000007 3300025916 Bacteria 208566
78 Ga0207646_10000084 3300025922 Bacteria 125911
79 Ga0207646_10136854 3300025922 Bacteria 2205
80 Ga0207665_10038296 3300025939 Bacteria 3192
81 Ga0207665_10293739 3300025939 Unclassified 1213
82 Ga0207667_10003673 3300025949 Bacteria 18918
83 Ga0207703_10255366 3300026035 Bacteria 1582
84 Ga0207641_10349017 3300026088 Bacteria 1410
85 Ga0207676_10603927 3300026095 Unclassified 1054
86 Ga0207428_10019441 3300027907 Bacteria 5791
87 Ga0268264_10005083 3300028381 Bacteria 11143
88 Ga0268264_10068760 3300028381 Bacteria 2994
89 Ga0268264_10513256 3300028381 Bacteria 1170
90 Ga0395905_0006678 3300037471 Bacteria 11564
91 Ga0436365_0569017 3300039437 Unclassified 2715
92 Ga0436365_1643539 3300039437 Bacteria 19806
93 Ga0451807_1146683 3300041486 Bacteria 1910
94 Ga0451807_1515812 3300041486 Bacteria 2451
95 Ga0451849_0033530 3300041505 Bacteria 2646
96 Ga0453683_0051909 3300044673 Bacteria 2568
97 Ga0453683_0169147 3300044673 Bacteria 1384
98 Ga0453684_0199551 3300044712 Bacteria 2333
99 Ga0496102_0038278 3300048905 Bacteria 4328
100 Ga0496109_0000064 3300048912 Bacteria 112316
101 Ga0501076_0041738 3300049592 Unclassified 3611
102 Ga0501045_0054321 3300049824 Bacteria 2928
103 nmdc:mga05p37_338_c1 3300050507 Bacteria 50240
104 nmdc:mga05p37_35715_c1 3300050507 Bacteria 6095
105 nmdc:mga05p37_55570_c1 3300050507 Bacteria 4872
106 nmdc:mga05p37_734735_c1 3300050507 Bacteria 1091
107 nmdc:mga05p37_80644_c1 3300050507 Bacteria 4008
108 nmdc:mga09592_3300_c1 3300050508 Bacteria 13064
109 nmdc:mga0qj67_347007_c1 3300050509 Bacteria 1200
110 nmdc:mga06r32_51418_c1 3300050510 Bacteria 3944
111 nmdc:mga08y16_1320_c1 3300050511 Bacteria 24657
112 nmdc:mga0n895_102172_c1 3300050512 Bacteria 2877
113 nmdc:mga0n895_585472_c1 3300050512 Bacteria 1119
114 nmdc:mga0rr50_71427_c1 3300050513 Bacteria 2648
115 nmdc:mga08x19_16960_c1 3300050514 Bacteria 4450
116 nmdc:mga08x19_216704_c1 3300050514 Bacteria 1315
117 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
118 nmdc:mga0a205_17552_c1 3300050515 Bacteria 6713
119 nmdc:mga0a205_250635_c1 3300050515 Bacteria 1650
120 Ga0501084_0044224 3300054114 Bacteria 3728
121 Ga0501082_0425168 3300060353 Bacteria 1160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1146683 Ga0451807_1146683_1049_1816 237
2 3300005434 Ga0070709_10004355 Ga0070709_100043552 253
3 3300025906 Ga0207699_10073607 Ga0207699_100736071 253
4 3300009094 Ga0111539_10170607 Ga0111539_101706073 257
5 3300006173 Ga0070716_100151832 Ga0070716_1001518322 258
6 3300006871 Ga0075434_100117463 Ga0075434_1001174632 260
7 3300050512 nmdc:mga0n895_102172_c1 nmdc:mga0n895_102172_c1_247_1095 260
8 3300050513 nmdc:mga0rr50_71427_c1 nmdc:mga0rr50_71427_c1_1350_2198 260
9 3300050515 nmdc:mga0a205_250635_c1 nmdc:mga0a205_250635_c1_730_1578 260
10 3300039437 Ga0436365_1643539 Ga0436365_1643539_14244_15107 265
11 3300005563 Ga0068855_100001511 Ga0068855_1000015114 267
12 3300025949 Ga0207667_10003673 Ga0207667_1000367318 267
13 3300006844 Ga0075428_100024517 Ga0075428_1000245172 269
14 3300006880 Ga0075429_100000495 Ga0075429_10000049530 269
15 3300006914 Ga0075436_100291269 Ga0075436_1002912691 269
16 3300009147 Ga0114129_10291654 Ga0114129_102916543 269
17 3300050507 nmdc:mga05p37_35715_c1 nmdc:mga05p37_35715_c1_4297_5199 269
18 3300050508 nmdc:mga09592_3300_c1 nmdc:mga09592_3300_c1_2758_3660 269
19 3300050509 nmdc:mga0qj67_347007_c1 nmdc:mga0qj67_347007_c1_213_1091 269
20 3300050512 nmdc:mga0n895_585472_c1 nmdc:mga0n895_585472_c1_233_1108 269
21 3300050514 nmdc:mga08x19_216704_c1 nmdc:mga08x19_216704_c1_79_990 269
22 3300005468 Ga0070707_100345864 Ga0070707_1003458642 270
23 3300006173 Ga0070716_100191969 Ga0070716_1001919692 270
24 3300007076 Ga0075435_100039613 Ga0075435_1000396133 270
25 3300006844 Ga0075428_100255291 Ga0075428_1002552912 271
26 3300006880 Ga0075429_100099421 Ga0075429_1000994213 271
27 3300009147 Ga0114129_10098393 Ga0114129_100983933 271
28 3300050514 nmdc:mga08x19_2_c1 nmdc:mga08x19_2_c1_108022_108930 272
29 3300005518 Ga0070699_100257585 Ga0070699_1002575852 273
30 3300009147 Ga0114129_10253877 Ga0114129_102538772 273
31 3300005468 Ga0070707_100226004 Ga0070707_1002260042 274
32 3300005471 Ga0070698_100026068 Ga0070698_1000260688 274
33 3300005545 Ga0070695_100317293 Ga0070695_1003172931 274
34 3300006914 Ga0075436_100013258 Ga0075436_1000132584 274
35 3300025922 Ga0207646_10136854 Ga0207646_101368542 274
36 3300041486 Ga0451807_1515812 Ga0451807_1515812_244_1140 274
37 3300048905 Ga0496102_0038278 Ga0496102_0038278_1848_2732 274
38 3300048912 Ga0496109_0000064 Ga0496109_0000064_100720_101616 274
39 3300049824 Ga0501045_0054321 Ga0501045_0054321_45_941 274
40 3300050507 nmdc:mga05p37_734735_c1 nmdc:mga05p37_734735_c1_133_1029 274
41 3300050510 nmdc:mga06r32_51418_c1 nmdc:mga06r32_51418_c1_1511_2407 274
42 3300050511 nmdc:mga08y16_1320_c1 nmdc:mga08y16_1320_c1_2878_3774 274
43 3300050514 nmdc:mga08x19_16960_c1 nmdc:mga08x19_16960_c1_1565_2464 274
44 3300050515 nmdc:mga0a205_17552_c1 nmdc:mga0a205_17552_c1_5701_6597 274
45 3300054114 Ga0501084_0044224 Ga0501084_0044224_129_1025 274
46 3300005468 Ga0070707_100000138 Ga0070707_1000001383 276
47 3300005468 Ga0070707_100247435 Ga0070707_1002474352 276
48 3300005518 Ga0070699_100026143 Ga0070699_1000261432 276
49 3300005985 Ga0081539_10005403 Ga0081539_1000540311 276
50 3300009147 Ga0114129_10019033 Ga0114129_100190337 276
51 3300025922 Ga0207646_10000084 Ga0207646_1000008456 276
52 3300044712 Ga0453684_0199551 Ga0453684_0199551_1376_2275 276
53 3300005438 Ga0070701_10104475 Ga0070701_101044751 277
54 3300005549 Ga0070704_100057379 Ga0070704_1000573791 277
55 3300009147 Ga0114129_10008651 Ga0114129_1000865111 277
56 3300050507 nmdc:mga05p37_338_c1 nmdc:mga05p37_338_c1_18416_19381 277
57 3300005328 Ga0070676_10008521 Ga0070676_100085216 278
58 3300005335 Ga0070666_10123744 Ga0070666_101237442 278
59 3300005549 Ga0070704_100055371 Ga0070704_1000553713 278
60 3300005843 Ga0068860_100002100 Ga0068860_10000210012 278
61 3300028381 Ga0268264_10005083 Ga0268264_1000508312 278
62 3300039437 Ga0436365_0569017 Ga0436365_0569017_1578_2492 278
63 3300005330 Ga0070690_100190282 Ga0070690_1001902822 279
64 3300005335 Ga0070666_10065860 Ga0070666_100658601 279
65 3300005471 Ga0070698_100237638 Ga0070698_1002376382 279
66 3300005842 Ga0068858_100423417 Ga0068858_1004234172 279
67 3300005937 Ga0081455_10030229 Ga0081455_100302294 279
68 3300005983 Ga0081540_1047951 Ga0081540_10479511 279
69 3300006847 Ga0075431_100501140 Ga0075431_1005011401 279
70 3300007076 Ga0075435_100086831 Ga0075435_1000868312 279
71 3300009177 Ga0105248_10379567 Ga0105248_103795672 279
72 3300026035 Ga0207703_10255366 Ga0207703_102553662 279
73 3300026088 Ga0207641_10349017 Ga0207641_103490171 279
74 3300027907 Ga0207428_10019441 Ga0207428_100194416 279
75 3300028381 Ga0268264_10513256 Ga0268264_105132561 279
76 3300041505 Ga0451849_0033530 Ga0451849_0033530_779_1717 279
77 3300006871 Ga0075434_100462727 Ga0075434_1004627272 280
78 3300044673 Ga0453683_0169147 Ga0453683_0169147_383_1351 280
79 3300049592 Ga0501076_0041738 Ga0501076_0041738_1064_1978 281
80 3300060353 Ga0501082_0425168 Ga0501082_0425168_182_1096 281
81 3300037471 Ga0395905_0006678 Ga0395905_0006678_9207_10133 282
82 3300005617 Ga0068859_100378551 Ga0068859_1003785511 283
83 3300005471 Ga0070698_100460890 Ga0070698_1004608901 285
84 3300005549 Ga0070704_100177861 Ga0070704_1001778613 285
85 3300009177 Ga0105248_10201126 Ga0105248_102011263 286
86 3300014325 Ga0163163_10193065 Ga0163163_101930652 286
87 3300025916 Ga0207663_10000007 Ga0207663_10000007111 287
88 3300025939 Ga0207665_10038296 Ga0207665_100382963 287
89 3300005295 Ga0065707_10128780 Ga0065707_101287802 288
90 3300005330 Ga0070690_100036753 Ga0070690_1000367535 288
91 3300005406 Ga0070703_10006633 Ga0070703_100066333 288
92 3300005434 Ga0070709_10000094 Ga0070709_1000009423 288
93 3300005440 Ga0070705_100000081 Ga0070705_1000000816 288
94 3300005445 Ga0070708_100181873 Ga0070708_1001818732 288
95 3300005467 Ga0070706_100000202 Ga0070706_10000020272 288
96 3300005518 Ga0070699_100000013 Ga0070699_100000013160 288
97 3300005546 Ga0070696_100000142 Ga0070696_10000014236 288
98 3300005547 Ga0070693_100009017 Ga0070693_1000090176 288
99 3300005577 Ga0068857_100133785 Ga0068857_1001337851 288
100 3300005618 Ga0068864_100633010 Ga0068864_1006330101 288
101 3300006844 Ga0075428_100006830 Ga0075428_10000683010 288
102 3300014325 Ga0163163_10312622 Ga0163163_103126222 288
103 3300025885 Ga0207653_10000071 Ga0207653_1000007176 288
104 3300025906 Ga0207699_10000008 Ga0207699_10000008141 288
105 3300025910 Ga0207684_10000204 Ga0207684_1000020489 288
106 3300026095 Ga0207676_10603927 Ga0207676_106039271 288
107 3300044673 Ga0453683_0051909 Ga0453683_0051909_1330_2334 288
108 3300050507 nmdc:mga05p37_55570_c1 nmdc:mga05p37_55570_c1_1490_2494 288
109 3300050507 nmdc:mga05p37_80644_c1 nmdc:mga05p37_80644_c1_2589_3566 288
110 3300025939 Ga0207665_10293739 Ga0207665_102937392 289
111 3300009101 Ga0105247_10087783 Ga0105247_100877832 292
112 3300009177 Ga0105248_10132747 Ga0105248_101327472 292
113 3300013297 Ga0157378_10000110 Ga0157378_100001102 292
114 3300005293 Ga0065715_10238924 Ga0065715_102389241 299
115 3300005440 Ga0070705_100065206 Ga0070705_1000652061 299
116 3300005544 Ga0070686_100018650 Ga0070686_1000186501 299
117 3300005547 Ga0070693_100139706 Ga0070693_1001397062 299
118 3300005843 Ga0068860_100020530 Ga0068860_1000205302 299
119 3300010375 Ga0105239_10266829 Ga0105239_102668292 299
120 3300014968 Ga0157379_10071842 Ga0157379_100718422 299
121 3300028381 Ga0268264_10068760 Ga0268264_100687603 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

77

303

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yrs-assembly2.cif.gz_B structure of a new variant of gnca ancestral beta-lactamase 0.84 50 297
5gs8-assembly1.cif.gz_A crystal structure of tla-3 extended-spectrum beta-lactamase 0.8331 47 296
6pq9-assembly1.cif.gz_A crystal structure of tla-1 s70g extended spectrum beta-lactamase 0.8297 47 297
2jbf-assembly3.cif.gz_C structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g. 0.8286 41 297
2j8y-assembly2.cif.gz_B structure of pbp-a acyl-enzyme complex with penicillin-g 0.8242 44 297
ID Description Score Start End Superfamily
5x5gA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8383 47 296 3.40.710.10
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8319 46 297 3.40.710.10
5ne2A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8239 60 293 3.40.710.10
5ul8A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8167 52 297 3.40.710.10
1mfoA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8088 46 299 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A7X6AKW5-F1-model_v4 deleted 0.9896 75 220
AF-A0A2V8HBI2-F1-model_v4 Serine hydrolase 0.9803 46 231 GO:0008800
GO:0030655
GO:0046677
AF-A0A2V7JVA8-F1-model_v4 Serine hydrolase 0.9768 84 206 GO:0008800
GO:0030655
GO:0046677
AF-A0A2V9DQ62-F1-model_v4 Serine hydrolase 0.967 59 299 GO:0008800
GO:0030655
GO:0046677
AF-A0A2V7UT02-F1-model_v4 Serine hydrolase 0.9649 57 295 GO:0008800
GO:0030655
GO:0046677

Feature Viewer

pLDDT pTM Quality
87.6 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map