F109402

General Info

Members Datasets Scaffolds Average Seq Length
121 98 242 77

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101208987|Ga0070696_1012089872
Length 75
Sequence MSDFSRITRDPEVMGGKPCIRGMRVTVGTIVGLVASRPGLKILQAYRYLEAEDIYEALAYAAWRVEEIEVPLVSP

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 2.48
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 34.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_101208987 3300005546 Bacteria 639
2 Ga0070691_10563619 3300005341 Unclassified 667
3 Ga0070659_101801297 3300005366 Unclassified 548
4 Ga0070659_102007851 3300005366 Unclassified 519
5 Ga0070711_102004588 3300005439 Unclassified 509
6 Ga0070705_100812014 3300005440 Bacteria 745
7 Ga0070706_100786877 3300005467 Unclassified 881
8 Ga0070707_100620890 3300005468 Bacteria 1043
9 Ga0070707_101628285 3300005468 Bacteria 613
10 Ga0070698_100019182 3300005471 Bacteria 7187
11 Ga0070698_100658461 3300005471 Bacteria 988
12 Ga0070699_100201810 3300005518 Unclassified 1768
13 Ga0070699_100494971 3300005518 Unclassified 1110
14 Ga0070679_101688519 3300005530 Unclassified 581
15 Ga0070686_100940313 3300005544 Unclassified 705
16 Ga0070696_100906880 3300005546 Unclassified 731
17 Ga0068859_101220743 3300005617 Unclassified 828
18 Ga0068866_10517093 3300005718 Unclassified 793
19 Ga0068861_100220838 3300005719 Bacteria 1602
20 Ga0068861_101156330 3300005719 Unclassified 746
21 Ga0068870_10110921 3300005840 Bacteria 1566
22 Ga0068860_101009117 3300005843 Unclassified 850
23 Ga0081455_10126900 3300005937 Unclassified 2000
24 Ga0070717_10326274 3300006028 Bacteria 1368
25 Ga0070712_101326901 3300006175 Unclassified 627
26 Ga0075367_10935625 3300006178 Unclassified 553
27 Ga0075429_101579491 3300006880 Unclassified 570
28 Ga0097620_101220686 3300006931 Unclassified 828
29 Ga0105251_10552037 3300009011 Unclassified 543
30 Ga0105245_10752977 3300009098 Bacteria 1010
31 Ga0114129_10043724 3300009147 Bacteria 6302
32 Ga0114129_10348207 3300009147 Bacteria 1963
33 Ga0114129_12110760 3300009147 Unclassified 679
34 Ga0157374_11058738 3300013296 Unclassified 831
35 Ga0163162_10412029 3300013306 Unclassified 1484
36 Ga0163163_13160189 3300014325 Unclassified 514
37 Ga0157379_10909816 3300014968 Viruses 835
38 Ga0207699_10294066 3300025906 Bacteria 1132
39 Ga0207699_11324734 3300025906 Bacteria 533
40 Ga0207643_10050266 3300025908 Bacteria 2364
41 Ga0207643_10096208 3300025908 Unclassified 1731
42 Ga0207684_11167299 3300025910 Unclassified 639
43 Ga0207707_10261443 3300025912 Bacteria 1502
44 Ga0207693_10720946 3300025915 Bacteria 772
45 Ga0207646_10120005 3300025922 Bacteria 2362
46 Ga0207687_10898316 3300025927 Bacteria 758
47 Ga0207669_10863387 3300025937 Bacteria 754
48 Ga0207665_10771728 3300025939 Bacteria 759
49 Ga0207711_11098721 3300025941 Unclassified 736
50 Ga0207641_10002136 3300026088 Bacteria 18697
51 Ga0207675_101230683 3300026118 Unclassified 769
52 Ga0207428_10000262 3300027907 Bacteria 72309
53 Ga0265337_1019673 3300028556 Bacteria 2125
54 Ga0265340_10073257 3300031247 Bacteria 1621
55 Ga0265327_10015133 3300031251 Bacteria 5001
56 Ga0265314_10490136 3300031711 Bacteria 648
57 Ga0316576_10548046 3300031727 Unclassified 848
58 Ga0316578_10936544 3300031728 Unclassified 500
59 Ga0307412_11181853 3300031911 Bacteria 684
60 Ga0307416_101662444 3300032002 Unclassified 743
61 Ga0316583_10079956 3300032133 Unclassified 1143
62 Ga0316583_10307235 3300032133 Unclassified 549
63 Ga0316574_0157904 3300035398 Bacteria 1461
64 Ga0316574_0275995 3300035398 Unclassified 1071
65 Ga0316574_0691880 3300035398 Bacteria 626
66 Ga0373947_0173247 3300035725 Bacteria 1401
67 Ga0316582_0330900 3300036647 Bacteria 1048
68 Ga0316582_1096579 3300036647 Bacteria 543
69 Ga0316582_1176957 3300036647 Unclassified 522
70 Ga0316584_0444928 3300036712 Bacteria 917
71 Ga0316584_0920967 3300036712 Bacteria 588
72 Ga0373925_0159337 3300037068 Bacteria 1777
73 Ga0400490_41799 3300038726 Bacteria 5431
74 Ga0451853_0387938 3300041512 Bacteria 630
75 Ga0451577_0016548 3300042876 Bacteria 6826
76 Ga0466966_0003884 3300044684 Bacteria 9873
77 Ga0466961_0090046 3300044693 Bacteria 1937
78 Ga0466963_1054870 3300044694 Bacteria 572
79 Ga0466964_0000322 3300044706 Bacteria 14250
80 Ga0453684_0000296 3300044712 Bacteria 211075
81 Ga0453684_0001117 3300044712 Bacteria 84116
82 Ga0466968_0104167 3300044735 Unclassified 1270
83 Ga0466970_0044864 3300044765 Bacteria 2353
84 Ga0466957_0094734 3300044842 Bacteria 1875
85 Ga0466959_0009780 3300045049 Bacteria 6831
86 Ga0466958_0232329 3300045836 Bacteria 1178
87 Ga0495620_0012485 3300046515 Bacteria 4383
88 Ga0495599_0724302 3300046678 Unclassified 572
89 Ga0495623_0276022 3300046679 Bacteria 937
90 Ga0495604_0252766 3300047317 Bacteria 1201
91 Ga0495684_0349982 3300047471 Bacteria 1049
92 Ga0496104_0485048 3300048907 Bacteria 1147
93 Ga0496106_0716634 3300048909 Unclassified 797
94 Ga0496109_0001575 3300048912 Bacteria 19036
95 Ga0501032_0000174 3300049569 Bacteria 52564
96 Ga0501032_0006545 3300049569 Bacteria 8555
97 Ga0501034_0213015 3300049571 Bacteria 1886
98 Ga0501036_0012966 3300049572 Bacteria 6920
99 Ga0501036_0038675 3300049572 Bacteria 4037
100 Ga0501039_0043799 3300049575 Bacteria 3457
101 Ga0501039_0446607 3300049575 Bacteria 1015
102 Ga0501042_0706927 3300049578 Unclassified 733
103 Ga0501043_0199176 3300049579 Bacteria 1555
104 Ga0501046_0008373 3300049580 Bacteria 9018
105 Ga0501047_0108166 3300049581 Bacteria 2662
106 Ga0501067_0018265 3300049583 Bacteria 3885
107 Ga0501068_0028846 3300049584 Bacteria 3284
108 Ga0501069_0024904 3300049585 Bacteria 3267
109 Ga0501073_0503343 3300049589 Bacteria 837
110 Ga0501075_0650971 3300049591 Unclassified 803
111 Ga0501079_1574792 3300049741 Bacteria 517
112 Ga0501080_0062843 3300049742 Bacteria 3455
113 nmdc:mga05p37_125743_c1 3300050507 Bacteria 3149
114 nmdc:mga05p37_494258_c1 3300050507 Bacteria 1406
115 nmdc:mga06r32_796075_c1 3300050510 Unclassified 906
116 nmdc:mga0n895_1331303_c1 3300050512 Unclassified 688
117 Ga0501084_1178090 3300054114 Bacteria 643
118 Ga0501082_0000186 3300060353 Bacteria 53655
119 Ga0501082_0006320 3300060353 Bacteria 10276
120 Ga0501082_0045759 3300060353 Bacteria 3773
121 Ga0466962_0000730 3300061719 Bacteria 14723
122 Ga0070696_101208987
123 Ga0070691_10563619
124 Ga0070659_101801297
125 Ga0070659_102007851
126 Ga0070711_102004588
127 Ga0070705_100812014
128 Ga0070706_100786877
129 Ga0070707_100620890
130 Ga0070707_101628285
131 Ga0070698_100019182
132 Ga0070698_100658461
133 Ga0070699_100201810
134 Ga0070699_100494971
135 Ga0070679_101688519
136 Ga0070686_100940313
137 Ga0070696_100906880
138 Ga0068859_101220743
139 Ga0068866_10517093
140 Ga0068861_100220838
141 Ga0068861_101156330
142 Ga0068870_10110921
143 Ga0068860_101009117
144 Ga0081455_10126900
145 Ga0070717_10326274
146 Ga0070712_101326901
147 Ga0075367_10935625
148 Ga0075429_101579491
149 Ga0097620_101220686
150 Ga0105251_10552037
151 Ga0105245_10752977
152 Ga0114129_10043724
153 Ga0114129_10348207
154 Ga0114129_12110760
155 Ga0157374_11058738
156 Ga0163162_10412029
157 Ga0163163_13160189
158 Ga0157379_10909816
159 Ga0207699_10294066
160 Ga0207699_11324734
161 Ga0207643_10050266
162 Ga0207643_10096208
163 Ga0207684_11167299
164 Ga0207707_10261443
165 Ga0207693_10720946
166 Ga0207646_10120005
167 Ga0207687_10898316
168 Ga0207669_10863387
169 Ga0207665_10771728
170 Ga0207711_11098721
171 Ga0207641_10002136
172 Ga0207675_101230683
173 Ga0207428_10000262
174 Ga0265337_1019673
175 Ga0265340_10073257
176 Ga0265327_10015133
177 Ga0265314_10490136
178 Ga0316576_10548046
179 Ga0316578_10936544
180 Ga0307412_11181853
181 Ga0307416_101662444
182 Ga0316583_10079956
183 Ga0316583_10307235
184 Ga0316574_0157904
185 Ga0316574_0275995
186 Ga0316574_0691880
187 Ga0373947_0173247
188 Ga0316582_0330900
189 Ga0316582_1096579
190 Ga0316582_1176957
191 Ga0316584_0444928
192 Ga0316584_0920967
193 Ga0373925_0159337
194 Ga0400490_41799
195 Ga0451853_0387938
196 Ga0451577_0016548
197 Ga0466966_0003884
198 Ga0466961_0090046
199 Ga0466963_1054870
200 Ga0466964_0000322
201 Ga0453684_0000296
202 Ga0453684_0001117
203 Ga0466968_0104167
204 Ga0466970_0044864
205 Ga0466957_0094734
206 Ga0466959_0009780
207 Ga0466958_0232329
208 Ga0495620_0012485
209 Ga0495599_0724302
210 Ga0495623_0276022
211 Ga0495604_0252766
212 Ga0495684_0349982
213 Ga0496104_0485048
214 Ga0496106_0716634
215 Ga0496109_0001575
216 Ga0501032_0000174
217 Ga0501032_0006545
218 Ga0501034_0213015
219 Ga0501036_0012966
220 Ga0501036_0038675
221 Ga0501039_0043799
222 Ga0501039_0446607
223 Ga0501042_0706927
224 Ga0501043_0199176
225 Ga0501046_0008373
226 Ga0501047_0108166
227 Ga0501067_0018265
228 Ga0501068_0028846
229 Ga0501069_0024904
230 Ga0501073_0503343
231 Ga0501075_0650971
232 Ga0501079_1574792
233 Ga0501080_0062843
234 nmdc:mga05p37_125743_c1
235 nmdc:mga05p37_494258_c1
236 nmdc:mga06r32_796075_c1
237 nmdc:mga0n895_1331303_c1
238 Ga0501084_1178090
239 Ga0501082_0000186
240 Ga0501082_0006320
241 Ga0501082_0045759
242 Ga0466962_0000730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04255

DUF433

Protein of unknown function (DUF433)

7

61

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.8706 6 70
4ldz-assembly1.cif.gz_B crystal structure of the full-length response regulator desr in the active state 0.846 27 68
5cy2-assembly1.cif.gz_A tn3 resolvase - site iii complex crystal form ii 0.8435 23 65
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.8431 27 68
5cy1-assembly1.cif.gz_A tn3 resolvase - site iii complex crystal form i 0.8341 23 65
ID Description Score Start End Superfamily
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8683 7 70 1.10.10.10
1r71D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;KorB DNA-binding domain 0.8247 27 62 1.10.10.730
2x48C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8245 27 60 1.10.10.60
1r71C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;KorB DNA-binding domain 0.8233 27 62 1.10.10.730
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8226 7 66 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A521QJN0-F1-model_v4 DUF433 domain-containing protein 0.9806 4 65
AF-A0A2M9ZRR8-F1-model_v4 Antitoxin 0.9751 4 67
AF-A0A521QCE8-F1-model_v4 DUF433 domain-containing protein 0.9743 6 59
AF-K9VS66-F1-model_v4 DUF433 domain-containing protein 0.9739 4 67
AF-A0A6P0RYW8-F1-model_v4 DUF433 domain-containing protein 0.9735 1 64

Map