F105981

General Info

Members Datasets Scaffolds Average Seq Length
120 93 240 278

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000083|Ga0163163_1000008311
Length 315
Sequence MFEAVGFRCTKPSDQSTEYNQHFTMKLSDQKPTDAVLASNEFSGLAEFIPAFAARPQISHVLFDFDGTLSLIRQGWPEVMVPMFVEMLPKLVGESEESRRQLCYDDIMRLNGKQTIYQMIQLSDRIKERGGVPQEPLWYKHEYLRRLDERIQDRLKDLRRGTVPTDEWLVYGARPLLELLQQRGLPLYLASGTDEIFVKQEAELLKLTSYFGKHIYGALDDYKQFSKKMVIERILRENGIQGNQLLSFGDGYVEIENTKEVGGLAVAVASDEANNGSGRYDSWKYRRLLGVGADVVIPDFRDAKPLLKRIFGEGS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
92 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
93 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.17
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10000083 3300014325 Bacteria 104503
2 Ga0065712_10068257 3300005290 Bacteria 12395
3 Ga0070690_100061108 3300005330 Unclassified 2426
4 Ga0070689_100002324 3300005340 Bacteria 12384
5 Ga0070689_100043821 3300005340 Unclassified 3441
6 Ga0070673_100115581 3300005364 Bacteria 2231
7 Ga0070688_100060712 3300005365 Bacteria 2388
8 Ga0070688_100141588 3300005365 Bacteria 1634
9 Ga0070709_10128636 3300005434 Bacteria 1726
10 Ga0070714_100317647 3300005435 Bacteria 1456
11 Ga0070705_100402191 3300005440 Unclassified 1014
12 Ga0070694_100039284 3300005444 Bacteria 3149
13 Ga0070662_100310562 3300005457 Bacteria 1283
14 Ga0070681_10287248 3300005458 Bacteria 1555
15 Ga0070685_10166859 3300005466 Bacteria 1408
16 Ga0070679_100193952 3300005530 Bacteria 1999
17 Ga0068853_100021821 3300005539 Bacteria 5342
18 Ga0070686_100000996 3300005544 Bacteria 16352
19 Ga0070665_100000407 3300005548 Bacteria 62972
20 Ga0070704_100004846 3300005549 Bacteria 7801
21 Ga0068859_100367948 3300005617 Bacteria 1533
22 Ga0068859_100728295 3300005617 Bacteria 1081
23 Ga0068863_100038881 3300005841 Unclassified 4527
24 Ga0068862_100690086 3300005844 Unclassified 988
25 Ga0075428_100005534 3300006844 Bacteria 14053
26 Ga0075428_100614803 3300006844 Bacteria 1160
27 Ga0075431_100063096 3300006847 Bacteria 3823
28 Ga0075431_100302705 3300006847 Unclassified 1615
29 Ga0075434_100807309 3300006871 Bacteria 954
30 Ga0075429_100246059 3300006880 Bacteria 1566
31 Ga0097620_100367965 3300006931 Bacteria 1533
32 Ga0097620_100728261 3300006931 Bacteria 1081
33 Ga0105240_10003475 3300009093 Bacteria 24446
34 Ga0105240_10416165 3300009093 Unclassified 1511
35 Ga0111539_10005456 3300009094 Bacteria 16454
36 Ga0111539_10042038 3300009094 Bacteria 5492
37 Ga0111539_10570163 3300009094 Bacteria 1318
38 Ga0105249_10271344 3300009553 Bacteria 1690
39 Ga0157378_10355210 3300013297 Unclassified 1433
40 Ga0157375_10000027 3300013308 Bacteria 220909
41 Ga0157375_10150235 3300013308 Bacteria 2464
42 Ga0157376_10210258 3300014969 Bacteria 1796
43 Ga0207695_10010957 3300025913 Bacteria 11026
44 Ga0207670_10001287 3300025936 Bacteria 13251
45 Ga0207670_10127440 3300025936 Unclassified 1859
46 Ga0207670_10236154 3300025936 Bacteria 1406
47 Ga0207668_10286145 3300025972 Unclassified 1354
48 Ga0207639_10031794 3300026041 Bacteria 3880
49 Ga0207708_10372160 3300026075 Bacteria 1176
50 Ga0207641_10039654 3300026088 Bacteria 3940
51 Ga0268266_10000214 3300028379 Bacteria 100889
52 Ga0265326_10010781 3300028558 Bacteria 2708
53 Ga0265322_10041785 3300028654 Bacteria 1305
54 Ga0265338_10011374 3300028800 Bacteria 10288
55 Ga0265338_10211068 3300028800 Bacteria 1457
56 Ga0265332_10031713 3300031238 Unclassified 2304
57 Ga0265325_10001289 3300031241 Bacteria 17783
58 Ga0265329_10005049 3300031242 Bacteria 5387
59 Ga0265339_10006380 3300031249 Bacteria 7753
60 Ga0265331_10005168 3300031250 Bacteria 7936
61 Ga0265313_10005898 3300031595 Bacteria 8871
62 Ga0316579_10080325 3300031691 Bacteria 1552
63 Ga0265314_10002894 3300031711 Bacteria 17042
64 Ga0265314_10003402 3300031711 Bacteria 15411
65 Ga0265342_10029279 3300031712 Bacteria 3420
66 Ga0316578_10193050 3300031728 Bacteria 1227
67 Ga0316577_10061218 3300031733 Bacteria 2101
68 Ga0373931_0269235 3300035691 Bacteria 1042
69 Ga0373935_0039900 3300035692 Bacteria 2944
70 Ga0373927_0013161 3300035695 Bacteria 5502
71 Ga0373947_0001185 3300035725 Bacteria 16047
72 Ga0373937_0480899 3300036401 Bacteria 1180
73 Ga0316582_0373257 3300036647 Bacteria 982
74 Ga0373925_0008734 3300037068 Bacteria 7380
75 Ga0395905_0269408 3300037471 Unclassified 1589
76 Ga0316581_0007110 3300037588 Bacteria 2989
77 Ga0395901_0515178 3300038443 Unclassified 1216
78 Ga0436365_1450993 3300039437 Bacteria 833
79 Ga0436360_0356157 3300039438 Unclassified 798
80 Ga0436363_1607523 3300039450 Bacteria 1173
81 Ga0451807_2135403 3300041486 Bacteria 1445
82 Ga0451577_0000880 3300042876 Bacteria 44582
83 Ga0451577_0116825 3300042876 Bacteria 2390
84 Ga0451577_0155886 3300042876 Bacteria 2055
85 Ga0453684_0000010 3300044712 Bacteria 1133422
86 Ga0453684_0337107 3300044712 Bacteria 1704
87 Ga0453684_0413644 3300044712 Bacteria 1508
88 Ga0451576_0431970 3300045051 Bacteria 1382
89 Ga0451576_0743665 3300045051 Bacteria 1030
90 Ga0451576_0768309 3300045051 Bacteria 1012
91 Ga0495639_0159517 3300046475 Bacteria 1091
92 Ga0495628_0355634 3300046516 Bacteria 1076
93 Ga0495630_0001914 3300046517 Bacteria 14509
94 Ga0495630_0295978 3300046517 Bacteria 1237
95 Ga0495666_0014946 3300046526 Unclassified 3864
96 Ga0495634_0043262 3300046642 Bacteria 3053
97 Ga0495599_0329197 3300046678 Bacteria 918
98 Ga0495658_0005828 3300046683 Bacteria 6048
99 Ga0495658_0150932 3300046683 Bacteria 1427
100 Ga0495669_0176640 3300046684 Unclassified 1017
101 Ga0495613_0004638 3300046689 Bacteria 10317
102 Ga0495624_0209759 3300046690 Bacteria 1182
103 Ga0495581_0186838 3300047315 Bacteria 1212
104 Ga0496114_0267337 3300048917 Bacteria 1507
105 Ga0496115_0076360 3300048918 Bacteria 2723
106 Ga0496115_0483330 3300048918 Bacteria 997
107 Ga0496115_0564073 3300048918 Bacteria 909
108 Ga0501033_0071995 3300049570 Bacteria 2539
109 Ga0501033_0095029 3300049570 Bacteria 2179
110 Ga0501034_0192546 3300049571 Unclassified 2001
111 Ga0501036_0426453 3300049572 Bacteria 1106
112 nmdc:mga09592_124704_c1 3300050508 Bacteria 2213
113 nmdc:mga09592_160867_c2 3300050508 Bacteria 1612
114 nmdc:mga06r32_316702_c1 3300050510 Bacteria 1545
115 nmdc:mga06r32_487302_c1 3300050510 Bacteria 1211
116 nmdc:mga08y16_80444_c1 3300050511 Bacteria 3397
117 Ga0495601_0194340 3300053077 Bacteria 1326
118 2688068501 2687453257 Bacteria 6784659
119 2889418052 2889415604 Bacteria 8048700
120 2920109815 2920107658 Bacteria 10042636
121 Ga0163163_10000083
122 Ga0065712_10068257
123 Ga0070690_100061108
124 Ga0070689_100002324
125 Ga0070689_100043821
126 Ga0070673_100115581
127 Ga0070688_100060712
128 Ga0070688_100141588
129 Ga0070709_10128636
130 Ga0070714_100317647
131 Ga0070705_100402191
132 Ga0070694_100039284
133 Ga0070662_100310562
134 Ga0070681_10287248
135 Ga0070685_10166859
136 Ga0070679_100193952
137 Ga0068853_100021821
138 Ga0070686_100000996
139 Ga0070665_100000407
140 Ga0070704_100004846
141 Ga0068859_100367948
142 Ga0068859_100728295
143 Ga0068863_100038881
144 Ga0068862_100690086
145 Ga0075428_100005534
146 Ga0075428_100614803
147 Ga0075431_100063096
148 Ga0075431_100302705
149 Ga0075434_100807309
150 Ga0075429_100246059
151 Ga0097620_100367965
152 Ga0097620_100728261
153 Ga0105240_10003475
154 Ga0105240_10416165
155 Ga0111539_10005456
156 Ga0111539_10042038
157 Ga0111539_10570163
158 Ga0105249_10271344
159 Ga0157378_10355210
160 Ga0157375_10000027
161 Ga0157375_10150235
162 Ga0157376_10210258
163 Ga0207695_10010957
164 Ga0207670_10001287
165 Ga0207670_10127440
166 Ga0207670_10236154
167 Ga0207668_10286145
168 Ga0207639_10031794
169 Ga0207708_10372160
170 Ga0207641_10039654
171 Ga0268266_10000214
172 Ga0265326_10010781
173 Ga0265322_10041785
174 Ga0265338_10011374
175 Ga0265338_10211068
176 Ga0265332_10031713
177 Ga0265325_10001289
178 Ga0265329_10005049
179 Ga0265339_10006380
180 Ga0265331_10005168
181 Ga0265313_10005898
182 Ga0316579_10080325
183 Ga0265314_10002894
184 Ga0265314_10003402
185 Ga0265342_10029279
186 Ga0316578_10193050
187 Ga0316577_10061218
188 Ga0373931_0269235
189 Ga0373935_0039900
190 Ga0373927_0013161
191 Ga0373947_0001185
192 Ga0373937_0480899
193 Ga0316582_0373257
194 Ga0373925_0008734
195 Ga0395905_0269408
196 Ga0316581_0007110
197 Ga0395901_0515178
198 Ga0436365_1450993
199 Ga0436360_0356157
200 Ga0436363_1607523
201 Ga0451807_2135403
202 Ga0451577_0000880
203 Ga0451577_0116825
204 Ga0451577_0155886
205 Ga0453684_0000010
206 Ga0453684_0337107
207 Ga0453684_0413644
208 Ga0451576_0431970
209 Ga0451576_0743665
210 Ga0451576_0768309
211 Ga0495639_0159517
212 Ga0495628_0355634
213 Ga0495630_0001914
214 Ga0495630_0295978
215 Ga0495666_0014946
216 Ga0495634_0043262
217 Ga0495599_0329197
218 Ga0495658_0005828
219 Ga0495658_0150932
220 Ga0495669_0176640
221 Ga0495613_0004638
222 Ga0495624_0209759
223 Ga0495581_0186838
224 Ga0496114_0267337
225 Ga0496115_0076360
226 Ga0496115_0483330
227 Ga0496115_0564073
228 Ga0501033_0071995
229 Ga0501033_0095029
230 Ga0501034_0192546
231 Ga0501036_0426453
232 nmdc:mga09592_124704_c1
233 nmdc:mga09592_160867_c2
234 nmdc:mga06r32_316702_c1
235 nmdc:mga06r32_487302_c1
236 nmdc:mga08y16_80444_c1
237 Ga0495601_0194340
238 2688068501
239 2889418052
240 2920109815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

61

268

0.76

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

58

262

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.8382 133 179
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.8063 133 229
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.7824 136 260
6iuy-assembly1.cif.gz_B structure of dsgpdh of dunaliella salina 0.7599 126 271
5oly-assembly1.cif.gz_G 5-fluorotryptophan labeled beta-phosphoglucomutase in a closed conformation, monoclinic crystal form 0.7442 19 270
ID Description Score Start End Superfamily
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8521 134 227 3.40.50.1000
af_Q6EP66_224_294_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8488 189 230 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8428 131 231 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.828 133 268 3.40.50.1000
2hszB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8263 131 267 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2G2J1V5-F1-model_v4 deleted 0.9868 6 271
AF-A0A7V3TXJ4-F1-model_v4 HAD family hydrolase 0.9853 7 270 GO:0006281
GO:0008967
AF-A0A7C7XCG8-F1-model_v4 GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II) 0.9835 6 271 GO:0003935
GO:0005525
GO:0005829
GO:0008270
GO:0008686
GO:0009231
AF-A0A3D4FBC6-F1-model_v4 Haloacid dehalogenase 0.9835 67 273 GO:0005829
GO:0006281
GO:0008967
AF-A0A7C3RAV5-F1-model_v4 HAD family hydrolase 0.9794 6 274 GO:0005829
GO:0006281
GO:0008967

Map