F101660

General Info

Members Datasets Scaffolds Average Seq Length
119 88 101 239

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10035065|Ga0157370_100350654
Length 275
Sequence VISAQATKKNAMASVVKYLFLTKSIFMKLIFLTFLLSLSLMVNAQNNFKATQIKFERVEKAYNEKWETLKKFVRADGYGDQFSMVINAYKSEGKLEIWLKNNADKNYKLFRTYDFCVHSGTLGPKVIEGDGQTHEGFYYVNVFNPMSNFHLSLGINYPNSVDSFRTGKDRKTGGDIYIHGNCVTVGCIPLTDEKIKEVYVLGVEARNAGQEKIPVNIYPFKMTDGNMKKYIAHFPTQANFWKSLQAGYLAFEKNKYPAEIKEVKGQYLITKEVKF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
13 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
14 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
15 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
16 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
17 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
18 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
19 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
75 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
88 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.87
Metatranscriptomes 0
Isolates 15.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 0
Rhizoplane 1.68
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 15.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1979726 2162886007 Bacteria 1632
2 JGI25152J39213_1000079 3300002773 Bacteria 65820
3 JGI25150J39212_1000014 3300002774 Bacteria 170955
4 JGI25151J46595_10000042 3300003187 Bacteria 170955
5 JGI25153J46596_10000009 3300003215 Bacteria 340925
6 rootH1_10099147 3300003316 Bacteria 2062
7 rootL2_10249665 3300003322 Bacteria 2728
8 Ga0055536_1000019 3300003781 Bacteria 203087
9 Ga0055530_10003660 3300003791 Bacteria 8598
10 Ga0055531_10000235 3300003794 Bacteria 60560
11 Ga0065714_10002771 3300005288 Bacteria 27225
12 Ga0065714_10064509 3300005288 Bacteria 45554
13 Ga0065714_10065895 3300005288 Bacteria 8167
14 Ga0065714_10078015 3300005288 Bacteria 2634
15 Ga0065704_10002638 3300005289 Bacteria 8395
16 Ga0065704_10070962 3300005289 Bacteria 14215
17 Ga0070690_100298002 3300005330 Unclassified 1155
18 Ga0070685_10010819 3300005466 Bacteria 4754
19 Ga0068859_100606719 3300005617 Bacteria 1187
20 Ga0068860_100357425 3300005843 Bacteria 1438
21 Ga0068862_100242471 3300005844 Bacteria 1639
22 Ga0075428_100026391 3300006844 Bacteria 6430
23 Ga0097620_100606701 3300006931 Bacteria 1187
24 Ga0105244_10033781 3300009036 Bacteria 2695
25 Ga0111539_10010681 3300009094 Bacteria 11563
26 Ga0111539_10043212 3300009094 Bacteria 5404
27 Ga0105249_10140884 3300009553 Unclassified 2312
28 Ga0157373_10000403 3300013100 Bacteria 34709
29 Ga0157373_10006698 3300013100 Bacteria 8577
30 Ga0157373_10207341 3300013100 Bacteria 1382
31 Ga0157371_10000220 3300013102 Bacteria 83813
32 Ga0157371_10002091 3300013102 Bacteria 19502
33 Ga0157371_10007834 3300013102 Bacteria 8575
34 Ga0157371_10104739 3300013102 Bacteria 2007
35 Ga0157370_10003830 3300013104 Bacteria 17540
36 Ga0157370_10006395 3300013104 Bacteria 12998
37 Ga0157370_10020076 3300013104 Bacteria 6682
38 Ga0157370_10035065 3300013104 Bacteria 4881
39 Ga0157370_10062560 3300013104 Bacteria 3529
40 Ga0157370_10202601 3300013104 Bacteria 1841
41 Ga0157370_10789094 3300013104 Bacteria 864
42 Ga0157369_10000031 3300013105 Bacteria 203214
43 Ga0157374_10157851 3300013296 Bacteria 2208
44 Ga0163162_10000227 3300013306 Bacteria 51464
45 Ga0157372_10101899 3300013307 Bacteria 3279
46 Ga0182008_10000034 3300014497 Bacteria 138235
47 Ga0182008_10000572 3300014497 Bacteria 27252
48 Ga0182006_1000159 3300015261 Bacteria 72265
49 Ga0182006_1000237 3300015261 Bacteria 52084
50 Ga0182006_1002314 3300015261 Bacteria 10497
51 Ga0182007_10000002 3300015262 Bacteria 564661
52 Ga0183373_1004 3300015682 Bacteria 537398
53 Ga0163161_10002660 3300017792 Bacteria 12700
54 Ga0163161_10004690 3300017792 Bacteria 9507
55 Ga0163161_10049926 3300017792 Bacteria 3025
56 Ga0163161_10171780 3300017792 Bacteria 1658
57 Ga0163161_10323220 3300017792 Bacteria 1220
58 Ga0207425_1000023 3300025245 Bacteria 341339
59 Ga0209129_1000032 3300025258 Bacteria 341150
60 Ga0209676_1000009 3300025292 Bacteria 981719
61 Ga0209025_1000047 3300025294 Bacteria 341150
62 Ga0209758_1000145 3300025297 Bacteria 170553
63 Ga0209050_1000094 3300025298 Bacteria 242893
64 Ga0209257_1000023 3300025304 Bacteria 753019
65 Ga0207712_10089118 3300025961 Unclassified 2267
66 Ga0268264_10309515 3300028381 Bacteria 1490
67 Ga0307515_10031825 3300028794 Bacteria 8766
68 Ga0307515_10089764 3300028794 Bacteria 3864
69 Ga0307513_10103395 3300031456 Bacteria 2865
70 Ga0307509_10177564 3300031507 Unclassified 1999
71 Ga0307405_10000015 3300031731 Bacteria 206299
72 Ga0307407_10000031 3300031903 Bacteria 87995
73 Ga0307412_10000049 3300031911 Bacteria 151588
74 Ga0307412_10683565 3300031911 Bacteria 879
75 Ga0307416_100000002 3300032002 Bacteria 509907
76 Ga0307414_10020690 3300032004 Bacteria 4107
77 Ga0307414_10092435 3300032004 Bacteria 2252
78 Ga0307414_10099884 3300032004 Bacteria 2181
79 Ga0307414_10852976 3300032004 Bacteria 833
80 Ga0395899_0000037 3300037312 Bacteria 280224
81 Ga0395900_0693131 3300037418 Bacteria 952
82 Ga0451802_1798668 3300041460 Unclassified 1119
83 Ga0451807_0031470 3300041486 Bacteria 2481
84 Ga0451849_0394319 3300041505 Unclassified 1053
85 Ga0451851_0767948 3300041507 Unclassified 1670
86 Ga0451577_0073861 3300042876 Bacteria 3042
87 Ga0453683_0048292 3300044673 Bacteria 2670
88 Ga0453684_0002915 3300044712 Bacteria 40093
89 Ga0453684_0089495 3300044712 Bacteria 3807
90 Ga0453684_0094352 3300044712 Unclassified 3681
91 Ga0453684_0308506 3300044712 Bacteria 1796
92 Ga0451576_0012403 3300045051 Bacteria 9572
93 Ga0495638_0000001 3300046460 Bacteria 1114121
94 Ga0495606_0038322 3300046507 Bacteria 3244
95 Ga0495610_0001576 3300046512 Bacteria 20073
96 Ga0495632_0171014 3300046519 Bacteria 998
97 Ga0495633_0022208 3300046558 Bacteria 3163
98 Ga0501241_005133 3300049758 Bacteria 2445
99 nmdc:mga08y16_42504_c1 3300050511 Unclassified 4760
100 Ga0500651_0003850 3300053093 Bacteria 8299
101 Ga0500616_0000009 3300053153 Bacteria 779095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10103395 Ga0307513_101033952 191
2 3300031507 Ga0307509_10177564 Ga0307509_101775642 222
3 3300005617 Ga0068859_100606719 Ga0068859_1006067192 223
4 3300005844 Ga0068862_100242471 Ga0068862_1002424712 223
5 3300006931 Ga0097620_100606701 Ga0097620_1006067012 223
6 3300009553 Ga0105249_10140884 Ga0105249_101408841 223
7 3300025961 Ga0207712_10089118 Ga0207712_100891181 223
8 3300013104 Ga0157370_10003830 Ga0157370_1000383016 224
9 iso_pu_bacteria 2775506987 2776615199 224
10 iso_pu_bacteria 2585427687 2586209839 225
11 iso_pu_bacteria 2738541302 2738855441 225
12 iso_pu_bacteria 2818991437 2819546171 225
13 iso_pu_bacteria 2842722452 2842723991 225
14 3300003794 Ga0055531_10000235 Ga0055531_1000023515 226
15 3300025304 Ga0209257_1000023 Ga0209257_1000023126 226
16 3300003322 rootL2_10249665 rootL2_102496654 227
17 3300006844 Ga0075428_100026391 Ga0075428_1000263912 227
18 3300042876 Ga0451577_0073861 Ga0451577_0073861_2240_2938 227
19 3300044712 Ga0453684_0002915 Ga0453684_0002915_13390_14088 227
20 3300046512 Ga0495610_0001576 Ga0495610_0001576_8686_9375 228
21 3300003316 rootH1_10099147 rootH1_100991471 229
22 3300005466 Ga0070685_10010819 Ga0070685_100108193 229
23 3300005843 Ga0068860_100357425 Ga0068860_1003574251 229
24 3300009036 Ga0105244_10033781 Ga0105244_100337812 229
25 3300013100 Ga0157373_10207341 Ga0157373_102073412 229
26 3300013102 Ga0157371_10000220 Ga0157371_1000022055 229
27 3300013102 Ga0157371_10104739 Ga0157371_101047392 229
28 3300013105 Ga0157369_10000031 Ga0157369_10000031118 229
29 3300013296 Ga0157374_10157851 Ga0157374_101578514 229
30 3300013306 Ga0163162_10000227 Ga0163162_100002277 229
31 3300013307 Ga0157372_10101899 Ga0157372_101018992 229
32 3300014497 Ga0182008_10000572 Ga0182008_1000057215 229
33 3300015261 Ga0182006_1000237 Ga0182006_100023719 229
34 3300015262 Ga0182007_10000002 Ga0182007_10000002148 229
35 3300017792 Ga0163161_10004690 Ga0163161_100046905 229
36 3300017792 Ga0163161_10049926 Ga0163161_100499263 229
37 3300017792 Ga0163161_10171780 Ga0163161_101717802 229
38 3300017792 Ga0163161_10323220 Ga0163161_103232202 229
39 3300028381 Ga0268264_10309515 Ga0268264_103095152 229
40 3300032004 Ga0307414_10852976 Ga0307414_108529761 229
41 3300041460 Ga0451802_1798668 Ga0451802_1798668_334_1047 229
42 3300041486 Ga0451807_0031470 Ga0451807_0031470_1392_2102 229
43 3300041505 Ga0451849_0394319 Ga0451849_0394319_279_989 229
44 3300041507 Ga0451851_0767948 Ga0451851_0767948_224_937 229
45 3300046507 Ga0495606_0038322 Ga0495606_0038322_1349_2041 229
46 3300046558 Ga0495633_0022208 Ga0495633_0022208_1924_2616 229
47 3300005330 Ga0070690_100298002 Ga0070690_1002980021 230
48 3300037312 Ga0395899_0000037 Ga0395899_0000037_125888_126643 230
49 3300037418 Ga0395900_0693131 Ga0395900_0693131_139_894 230
50 3300009094 Ga0111539_10010681 Ga0111539_100106816 231
51 3300009094 Ga0111539_10043212 Ga0111539_100432123 231
52 3300013100 Ga0157373_10006698 Ga0157373_100066982 231
53 3300013104 Ga0157370_10202601 Ga0157370_102026013 231
54 3300046460 Ga0495638_0000001 Ga0495638_0000001_474931_475656 231
55 3300046519 Ga0495632_0171014 Ga0495632_0171014_27_755 231
56 3300050511 nmdc:mga08y16_42504_c1 nmdc:mga08y16_42504_c1_3019_3741 231
57 3300053153 Ga0500616_0000009 Ga0500616_0000009_257896_258621 231
58 2162886007 SwRhRL2b_contig_1979726 SwRhRL2b_0446.00006820 232
59 3300002773 JGI25152J39213_1000079 JGI25152J39213_100007919 232
60 3300002774 JGI25150J39212_1000014 JGI25150J39212_1000014141 232
61 3300003187 JGI25151J46595_10000042 JGI25151J46595_10000042141 232
62 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009141 232
63 3300003781 Ga0055536_1000019 Ga0055536_100001929 232
64 3300003791 Ga0055530_10003660 Ga0055530_100036608 232
65 3300005288 Ga0065714_10002771 Ga0065714_1000277124 232
66 3300005288 Ga0065714_10064509 Ga0065714_1006450929 232
67 3300005288 Ga0065714_10065895 Ga0065714_100658956 232
68 3300005288 Ga0065714_10078015 Ga0065714_100780152 232
69 3300005289 Ga0065704_10002638 Ga0065704_100026381 232
70 3300005289 Ga0065704_10070962 Ga0065704_100709627 232
71 3300013100 Ga0157373_10000403 Ga0157373_100004032 232
72 3300013102 Ga0157371_10002091 Ga0157371_100020917 232
73 3300013102 Ga0157371_10007834 Ga0157371_100078347 232
74 3300013104 Ga0157370_10006395 Ga0157370_100063957 232
75 3300013104 Ga0157370_10020076 Ga0157370_100200763 232
76 3300013104 Ga0157370_10035065 Ga0157370_100350654 232
77 3300013104 Ga0157370_10062560 Ga0157370_100625602 232
78 3300013104 Ga0157370_10789094 Ga0157370_107890941 232
79 3300014497 Ga0182008_10000034 Ga0182008_1000003474 232
80 3300015261 Ga0182006_1000159 Ga0182006_10001592 232
81 3300015261 Ga0182006_1002314 Ga0182006_10023146 232
82 3300015682 Ga0183373_1004 Ga0183373_1004329 232
83 3300017792 Ga0163161_10002660 Ga0163161_100026602 232
84 3300025245 Ga0207425_1000023 Ga0207425_1000023140 232
85 3300025258 Ga0209129_1000032 Ga0209129_1000032133 232
86 3300025292 Ga0209676_1000009 Ga0209676_1000009151 232
87 3300025294 Ga0209025_1000047 Ga0209025_1000047133 232
88 3300025297 Ga0209758_1000145 Ga0209758_1000145140 232
89 3300025298 Ga0209050_1000094 Ga0209050_1000094151 232
90 3300028794 Ga0307515_10031825 Ga0307515_100318256 232
91 3300028794 Ga0307515_10089764 Ga0307515_100897643 232
92 3300031731 Ga0307405_10000015 Ga0307405_1000001522 232
93 3300031903 Ga0307407_10000031 Ga0307407_1000003112 232
94 3300031911 Ga0307412_10000049 Ga0307412_1000004952 232
95 3300031911 Ga0307412_10683565 Ga0307412_106835651 232
96 3300032002 Ga0307416_100000002 Ga0307416_100000002132 232
97 3300032004 Ga0307414_10020690 Ga0307414_100206902 232
98 3300032004 Ga0307414_10092435 Ga0307414_100924351 232
99 3300032004 Ga0307414_10099884 Ga0307414_100998842 232
100 3300044673 Ga0453683_0048292 Ga0453683_0048292_1880_2608 232
101 3300044712 Ga0453684_0089495 Ga0453684_0089495_1824_2552 232
102 3300044712 Ga0453684_0094352 Ga0453684_0094352_1454_2227 232
103 3300044712 Ga0453684_0308506 Ga0453684_0308506_386_1123 232
104 3300045051 Ga0451576_0012403 Ga0451576_0012403_2907_3635 232
105 3300049758 Ga0501241_005133 Ga0501241_005133_554_1258 232
106 3300053093 Ga0500651_0003850 Ga0500651_0003850_3028_3732 232
107 iso_pu_bacteria 2738541284 2738762178 232
108 iso_pu_bacteria 2738543023 2739303483 232
109 iso_pu_bacteria 2739367651 2739588206 232
110 iso_pu_bacteria 2739367656 2739614011 232
111 iso_pu_bacteria 2842909656 2842912277 232
112 iso_pu_bacteria 2849281842 2849282713 232
113 iso_pu_bacteria 2852627209 2852629194 232
114 iso_pu_bacteria 2857627736 2857629378 232
115 iso_pu_bacteria 2902048731 2902049462 232
116 iso_pu_bacteria 2904445276 2904446456 232
117 iso_pu_bacteria 2919186247 2919189209 232
118 iso_pu_bacteria 2939664404 2939666636 232
119 iso_pu_bacteria 2945997725 2945999261 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

83

217

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ikr-assembly1.cif.gz_B crystal structure of dpaa 0.9282 46 232
8ikr-assembly1.cif.gz_A crystal structure of dpaa 0.924 46 232
8ikr-assembly1.cif.gz_B crystal structure of dpaa 0.8883 46 232
8ikr-assembly1.cif.gz_A crystal structure of dpaa 0.8647 46 232
1nu0-assembly2.cif.gz_B structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.7873 43 77
ID Description Score Start End Superfamily
af_P0AA99_43_186_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9403 47 191 2.40.440.10
af_P0AA99_43_186_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9214 47 191 2.40.440.10
af_A0A0P0XI97_1_184_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7633 45 77 2.60.120.200
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.757 45 77 3.30.420.140
af_P36122_96_690_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7395 43 77 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A327T8H1-F1-model_v4 L,D-transpeptidase-like protein 0.9885 1 219 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A4R6IIN6-F1-model_v4 L,D-transpeptidase-like protein 0.9869 7 232 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A519XIM1-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9819 73 232 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A0N0CXX0-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9782 19 232 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A4R2Z3D7-F1-model_v4 deleted 0.9776 1 232

Feature Viewer

pLDDT pTM Quality
91.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map