F099797

General Info

Members Datasets Scaffolds Average Seq Length
119 91 238 96

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10232598|rootH2_102325984
Length 98
Sequence VTKLYYHRLAVRDVRQILDHYETEAGDGLADRFFETLLAVLEKARASRLCYPPLGLRLRRANLPGFPYHVLYEETASVVKVLVVRHHRRHPNYGLRRK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
88 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
89 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
90 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 0
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 47.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10232598 3300003320 Bacteria 3037
2 rootL2_10229050 3300003322 Bacteria 2507
3 Ga0065704_10109248 3300005289 Unclassified 2008
4 Ga0065715_10319681 3300005293 Unclassified 1004
5 Ga0065707_10047834 3300005295 Unclassified 592
6 Ga0065707_10142247 3300005295 Unclassified 1757
7 Ga0070670_100075217 3300005331 Bacteria 2902
8 Ga0070666_10184755 3300005335 Bacteria 1463
9 Ga0070692_10847715 3300005345 Unclassified 628
10 Ga0070675_100783622 3300005354 Unclassified 871
11 Ga0070688_101313514 3300005365 Unclassified 584
12 Ga0070710_10034981 3300005437 Bacteria 2736
13 Ga0070701_10402434 3300005438 Unclassified 868
14 Ga0070705_100289794 3300005440 Unclassified 1168
15 Ga0070705_100694760 3300005440 Unclassified 798
16 Ga0070700_100068959 3300005441 Bacteria 2250
17 Ga0070694_100055646 3300005444 Unclassified 2684
18 Ga0070694_100234453 3300005444 Bacteria 1382
19 Ga0070708_101749606 3300005445 Unclassified 577
20 Ga0070706_100000050 3300005467 Bacteria 140240
21 Ga0070706_100091304 3300005467 Unclassified 2824
22 Ga0070698_100001589 3300005471 Bacteria 25260
23 Ga0070697_100000437 3300005536 Bacteria 31889
24 Ga0068853_100415926 3300005539 Bacteria 1260
25 Ga0070686_100032435 3300005544 Bacteria 3203
26 Ga0070696_100026068 3300005546 Bacteria 3976
27 Ga0070665_101583424 3300005548 Bacteria 663
28 Ga0068857_100961089 3300005577 Unclassified 821
29 Ga0068857_101034611 3300005577 Unclassified 791
30 Ga0068852_100909208 3300005616 Unclassified 897
31 Ga0068864_100032993 3300005618 Bacteria 4400
32 Ga0068864_100710413 3300005618 Bacteria 982
33 Ga0068864_102116218 3300005618 Unclassified 569
34 Ga0068870_10008262 3300005840 Bacteria 4673
35 Ga0068870_10169481 3300005840 Bacteria 1302
36 Ga0068870_11455940 3300005840 Unclassified 503
37 Ga0068863_100892007 3300005841 Unclassified 889
38 Ga0068862_100017145 3300005844 Bacteria 6026
39 Ga0068862_100135434 3300005844 Unclassified 2182
40 Ga0070712_100620520 3300006175 Bacteria 917
41 Ga0097621_101885048 3300006237 Unclassified 570
42 Ga0075428_100176105 3300006844 Bacteria 2316
43 Ga0075430_100010467 3300006846 Bacteria 7854
44 Ga0075433_10055326 3300006852 Bacteria 3463
45 Ga0075433_10090831 3300006852 Bacteria 2699
46 Ga0075433_10245376 3300006852 Bacteria 1590
47 Ga0075433_11291519 3300006852 Unclassified 632
48 Ga0075434_102529584 3300006871 Unclassified 514
49 Ga0075435_100291296 3300007076 Unclassified 1395
50 Ga0099794_10802650 3300007265 Unclassified 503
51 Ga0105240_10018198 3300009093 Bacteria 9444
52 Ga0111539_10442665 3300009094 Bacteria 1513
53 Ga0105245_11328139 3300009098 Unclassified 768
54 Ga0114129_10183912 3300009147 Bacteria 2842
55 Ga0114129_10728067 3300009147 Bacteria 1272
56 Ga0114129_12542324 3300009147 Unclassified 612
57 Ga0105248_12619465 3300009177 Unclassified 575
58 Ga0105249_10205383 3300009553 Bacteria 1930
59 Ga0105239_10248005 3300010375 Unclassified 2000
60 Ga0157373_10591244 3300013100 Bacteria 807
61 Ga0157374_11038093 3300013296 Unclassified 839
62 Ga0163162_10242661 3300013306 Bacteria 1933
63 Ga0163162_11052805 3300013306 Unclassified 921
64 Ga0163162_12879263 3300013306 Unclassified 554
65 Ga0157372_10007224 3300013307 Bacteria 11828
66 Ga0157379_10038832 3300014968 Bacteria 4247
67 Ga0213872_10009010 3300021361 Unclassified 4797
68 Ga0207692_10165001 3300025898 Bacteria 1279
69 Ga0207643_10228734 3300025908 Bacteria 1140
70 Ga0207643_10443202 3300025908 Unclassified 825
71 Ga0207684_10000131 3300025910 Bacteria 137508
72 Ga0207684_10009015 3300025910 Bacteria 8843
73 Ga0207695_10036379 3300025913 Bacteria 5323
74 Ga0207663_10569668 3300025916 Bacteria 887
75 Ga0207646_10016519 3300025922 Bacteria 6926
76 Ga0207650_10161471 3300025925 Bacteria 1776
77 Ga0207687_10531734 3300025927 Unclassified 984
78 Ga0207711_11130440 3300025941 Bacteria 724
79 Ga0207641_11271349 3300026088 Unclassified 736
80 Ga0207676_10003463 3300026095 Bacteria 11168
81 Ga0207674_10959704 3300026116 Unclassified 824
82 Ga0207674_11500769 3300026116 Unclassified 643
83 Ga0207698_10548153 3300026142 Bacteria 1133
84 Ga0209588_1121340 3300027671 Unclassified 836
85 Ga0207428_10027413 3300027907 Bacteria 4742
86 Ga0265337_1234287 3300028556 Unclassified 500
87 Ga0307511_10001498 3300030521 Bacteria 24721
88 Ga0265339_10156748 3300031249 Bacteria 1148
89 Ga0265316_10678377 3300031344 Unclassified 727
90 Ga0265316_10960301 3300031344 Unclassified 596
91 Ga0307416_100069475 3300032002 Unclassified 2915
92 Ga0307416_100635246 3300032002 Bacteria 1151
93 Ga0307414_10182874 3300032004 Bacteria 1688
94 Ga0307414_11039853 3300032004 Bacteria 755
95 Ga0307507_10023498 3300033179 Bacteria 6765
96 Ga0436361_0317667 3300039447 Bacteria 7858
97 Ga0453683_0816891 3300044673 Unclassified 614
98 Ga0451576_0024759 3300045051 Bacteria 6478
99 Ga0495629_1119497 3300046459 Bacteria 508
100 Ga0495651_0146376 3300046462 Unclassified 1708
101 Ga0495628_0000171 3300046516 Bacteria 56747
102 Ga0495645_0006122 3300046543 Bacteria 8325
103 Ga0495674_0423041 3300047319 Bacteria 1073
104 Ga0501080_0019423 3300049742 Bacteria 6295
105 Ga0501081_1465714 3300049743 Unclassified 518
106 nmdc:mga05p37_1530882_c1 3300050507 Unclassified 662
107 nmdc:mga05p37_1630979_c1 3300050507 Unclassified 633
108 nmdc:mga05p37_564409_c1 3300050507 Unclassified 1292
109 nmdc:mga08y16_162538_c1 3300050511 Bacteria 2320
110 nmdc:mga0n895_2191997_c1 3300050512 Unclassified 508
111 nmdc:mga0n895_544012_c1 3300050512 Unclassified 1167
112 nmdc:mga0rr50_418417_c1 3300050513 Unclassified 1133
113 nmdc:mga0a205_1195739_c1 3300050515 Unclassified 608
114 nmdc:mga0a205_607646_c1 3300050515 Bacteria 946
115 nmdc:mga0a205_731367_c1 3300050515 Unclassified 839
116 Ga0500627_0499798 3300053158 Unclassified 506
117 Ga0500637_0221646 3300053178 Bacteria 1069
118 Ga0590075_074292 3300059424 Bacteria 879
119 Ga0530510_1263072 3300061734 Unclassified 566
120 rootH2_10232598
121 rootL2_10229050
122 Ga0065704_10109248
123 Ga0065715_10319681
124 Ga0065707_10047834
125 Ga0065707_10142247
126 Ga0070670_100075217
127 Ga0070666_10184755
128 Ga0070692_10847715
129 Ga0070675_100783622
130 Ga0070688_101313514
131 Ga0070710_10034981
132 Ga0070701_10402434
133 Ga0070705_100289794
134 Ga0070705_100694760
135 Ga0070700_100068959
136 Ga0070694_100055646
137 Ga0070694_100234453
138 Ga0070708_101749606
139 Ga0070706_100000050
140 Ga0070706_100091304
141 Ga0070698_100001589
142 Ga0070697_100000437
143 Ga0068853_100415926
144 Ga0070686_100032435
145 Ga0070696_100026068
146 Ga0070665_101583424
147 Ga0068857_100961089
148 Ga0068857_101034611
149 Ga0068852_100909208
150 Ga0068864_100032993
151 Ga0068864_100710413
152 Ga0068864_102116218
153 Ga0068870_10008262
154 Ga0068870_10169481
155 Ga0068870_11455940
156 Ga0068863_100892007
157 Ga0068862_100017145
158 Ga0068862_100135434
159 Ga0070712_100620520
160 Ga0097621_101885048
161 Ga0075428_100176105
162 Ga0075430_100010467
163 Ga0075433_10055326
164 Ga0075433_10090831
165 Ga0075433_10245376
166 Ga0075433_11291519
167 Ga0075434_102529584
168 Ga0075435_100291296
169 Ga0099794_10802650
170 Ga0105240_10018198
171 Ga0111539_10442665
172 Ga0105245_11328139
173 Ga0114129_10183912
174 Ga0114129_10728067
175 Ga0114129_12542324
176 Ga0105248_12619465
177 Ga0105249_10205383
178 Ga0105239_10248005
179 Ga0157373_10591244
180 Ga0157374_11038093
181 Ga0163162_10242661
182 Ga0163162_11052805
183 Ga0163162_12879263
184 Ga0157372_10007224
185 Ga0157379_10038832
186 Ga0213872_10009010
187 Ga0207692_10165001
188 Ga0207643_10228734
189 Ga0207643_10443202
190 Ga0207684_10000131
191 Ga0207684_10009015
192 Ga0207695_10036379
193 Ga0207663_10569668
194 Ga0207646_10016519
195 Ga0207650_10161471
196 Ga0207687_10531734
197 Ga0207711_11130440
198 Ga0207641_11271349
199 Ga0207676_10003463
200 Ga0207674_10959704
201 Ga0207674_11500769
202 Ga0207698_10548153
203 Ga0209588_1121340
204 Ga0207428_10027413
205 Ga0265337_1234287
206 Ga0307511_10001498
207 Ga0265339_10156748
208 Ga0265316_10678377
209 Ga0265316_10960301
210 Ga0307416_100069475
211 Ga0307416_100635246
212 Ga0307414_10182874
213 Ga0307414_11039853
214 Ga0307507_10023498
215 Ga0436361_0317667
216 Ga0453683_0816891
217 Ga0451576_0024759
218 Ga0495629_1119497
219 Ga0495651_0146376
220 Ga0495628_0000171
221 Ga0495645_0006122
222 Ga0495674_0423041
223 Ga0501080_0019423
224 Ga0501081_1465714
225 nmdc:mga05p37_1530882_c1
226 nmdc:mga05p37_1630979_c1
227 nmdc:mga05p37_564409_c1
228 nmdc:mga08y16_162538_c1
229 nmdc:mga0n895_2191997_c1
230 nmdc:mga0n895_544012_c1
231 nmdc:mga0rr50_418417_c1
232 nmdc:mga0a205_1195739_c1
233 nmdc:mga0a205_607646_c1
234 nmdc:mga0a205_731367_c1
235 Ga0500627_0499798
236 Ga0500637_0221646
237 Ga0590075_074292
238 Ga0530510_1263072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

4

91

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kxe-assembly1.cif.gz_B a conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex 0.8779 4 86
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8678 1 90
8c24-assembly1.cif.gz_B parde1 toxin-antitoxin complex from mycobacterium tuberculosis (rv1960c-rv1959c) 0.8544 4 92
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.8481 1 90
8c26-assembly1.cif.gz_A parde2 toxin-antitoxin complex from mycobacterium tuberculosis (rv2142a-rv2142c) 0.839 1 86
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8892 2 90 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8616 1 90 3.30.2310.20
3kxeB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8484 4 86 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8331 4 91 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8181 1 92 3.30.2310.20
ID Description Score Start End GO Terms
AF-K9YFX6-F1-model_v4 Plasmid stabilization system 0.9664 2 86
AF-A0A4V0I6F4-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9552 5 86
AF-A0A326RKC0-F1-model_v4 ParE-like toxin of type II ParDE toxin-antitoxin system 0.9551 2 86
AF-A0A1M5DPQ6-F1-model_v4 ParE toxin of type II toxin-antitoxin system, parDE 0.9523 3 86
AF-A0A2V8PPR7-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9519 2 86

Map