F098967

General Info

Members Datasets Scaffolds Average Seq Length
118 105 236 228

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0005853|Ga0501031_0005853_2535_3329
Length 264
Sequence MGRFGIHAKKQGTGKGVGQRHGDNPNKTNRFSAMTDHTALTQDELKQRVGQAALQYVVPGEILGVGTGSTVNCFIDALATMKARIPGAVSSSEASSARLRALGIAVLDANEVQRLSVYIDGADEIDGHGCMIKGGGAALTREKIVAALADRFICIADASKRVDVLGRFPLPVEVIPMAVAQLTRRFAALGGVATVRLKDGTPLVTDNGQHILDVRGLAIADPLAFETEVSQWPGVVTVGVFAHQRASICLLGTPEGVRTIDFGS

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
42 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
54 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
65 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
66 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
88 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
94 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
95 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
96 2643221570 Acidovorax sp. Root568 Isolate Unclassified
97 2643221596 Acidovorax sp. Root70 Isolate Unclassified
98 2643221652 Acidovorax sp. Root402 Isolate Unclassified
99 2643221717 Acidovorax sp. Root267 Isolate Unclassified
100 2721755523 Delftia sp. HK171 Isolate Unclassified
101 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
102 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
103 2842733646 Variovorax sp. R-72446 Isolate Unclassified
104 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
105 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 0
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.32
Nodule 1.69
Rhizoplane 12.71
Rhizosphere 62.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0005853 3300049568 Bacteria 8012
2 JGI24740J21852_10004444 3300001979 Bacteria 6032
3 JGI24744J21845_10031715 3300002077 Bacteria 1009
4 JGI25153J46596_10002394 3300003215 Bacteria 10835
5 Ga0065714_10220426 3300005288 Bacteria 842
6 Ga0065704_10080652 3300005289 Bacteria 3906
7 Ga0070670_100021534 3300005331 Bacteria 5544
8 Ga0070673_100355966 3300005364 Bacteria 1300
9 Ga0070659_100102064 3300005366 Bacteria 2309
10 Ga0070667_100049896 3300005367 Bacteria 3526
11 Ga0068853_100491441 3300005539 Bacteria 1158
12 Ga0070665_100046614 3300005548 Bacteria 4353
13 Ga0068864_100090614 3300005618 Bacteria 2696
14 Ga0068870_10095367 3300005840 Bacteria 1671
15 Ga0068863_100276569 3300005841 Bacteria 1626
16 Ga0075365_10042953 3300006038 Bacteria 2958
17 Ga0075364_10027296 3300006051 Bacteria 3646
18 Ga0097621_100573268 3300006237 Bacteria 1029
19 Ga0075370_10168169 3300006353 Bacteria 1288
20 Ga0079104_1000007 3300006946 Bacteria 390531
21 Ga0105250_10009606 3300009092 Bacteria 4069
22 Ga0105243_10001726 3300009148 Bacteria 18821
23 Ga0105239_10819375 3300010375 Bacteria 1067
24 Ga0157378_10856928 3300013297 Bacteria 937
25 Ga0163162_10059086 3300013306 Bacteria 3866
26 Ga0163163_10290235 3300014325 Bacteria 1688
27 Ga0157376_10630440 3300014969 Bacteria 1070
28 Ga0182007_10001576 3300015262 Bacteria 12166
29 Ga0163161_10035909 3300017792 Bacteria 3548
30 Ga0213872_10000169 3300021361 Bacteria 58596
31 Ga0209257_1019008 3300025304 Bacteria 2609
32 Ga0207696_1043554 3300025711 Bacteria 1304
33 Ga0207706_10001939 3300025933 Bacteria 20308
34 Ga0207686_10219497 3300025934 Bacteria 1372
35 Ga0207709_10000439 3300025935 Bacteria 39121
36 Ga0207709_10357014 3300025935 Bacteria 1105
37 Ga0207669_10015881 3300025937 Bacteria 3810
38 Ga0207651_10153400 3300025960 Bacteria 1796
39 Ga0207658_10030644 3300025986 Bacteria 3811
40 Ga0207648_10197840 3300026089 Bacteria 1782
41 Ga0207683_10009173 3300026121 Bacteria 8427
42 Ga0207683_10038156 3300026121 Bacteria 4185
43 Ga0209281_1000020 3300027111 Bacteria 575972
44 Ga0209995_1006581 3300027471 Bacteria 1867
45 Ga0209974_10005569 3300027876 Bacteria 4426
46 Ga0307517_10003097 3300028786 Bacteria 26244
47 Ga0307515_10048179 3300028794 Bacteria 6450
48 Ga0307509_10034003 3300031507 Bacteria 5604
49 Ga0307408_100000538 3300031548 Bacteria 32684
50 Ga0307508_10023931 3300031616 Bacteria 5543
51 Ga0307514_10000395 3300031649 Bacteria 99171
52 Ga0307406_10009203 3300031901 Bacteria 5533
53 Ga0307412_10201755 3300031911 Bacteria 1511
54 Ga0307409_100659439 3300031995 Bacteria 1041
55 Ga0436361_0159126 3300039447 Bacteria 34073
56 Ga0436361_0413719 3300039447 Bacteria 3213
57 Ga0439435_0081402 3300042436 Bacteria 972
58 Ga0451577_0105493 3300042876 Bacteria 2519
59 Ga0451577_0190572 3300042876 Bacteria 1850
60 Ga0453683_0018295 3300044673 Bacteria 4498
61 Ga0453684_0043427 3300044712 Bacteria 6041
62 Ga0451576_0007881 3300045051 Bacteria 12620
63 Ga0451576_0071366 3300045051 Bacteria 3614
64 Ga0451576_0310112 3300045051 Bacteria 1651
65 Ga0451576_1201495 3300045051 Bacteria 792
66 Ga0495629_0200284 3300046459 Bacteria 1381
67 Ga0495639_0013615 3300046475 Bacteria 3516
68 Ga0495620_0091790 3300046515 Bacteria 1218
69 Ga0495642_0075819 3300046528 Bacteria 1411
70 Ga0495597_0000153 3300046542 Bacteria 61233
71 Ga0495633_0005087 3300046558 Bacteria 8171
72 Ga0495656_0148260 3300046615 Bacteria 1131
73 Ga0495668_0354131 3300046616 Bacteria 806
74 Ga0495657_0083111 3300046675 Bacteria 2068
75 Ga0495669_0054017 3300046684 Bacteria 1808
76 Ga0495669_0089597 3300046684 Bacteria 1419
77 Ga0495613_0294304 3300046689 Bacteria 1125
78 Ga0495685_033430 3300047447 Bacteria 1767
79 Ga0496100_0051845 3300048903 Bacteria 2665
80 Ga0496101_0013958 3300048904 Bacteria 5394
81 Ga0496102_0013747 3300048905 Bacteria 7020
82 Ga0496103_0006569 3300048906 Bacteria 6937
83 Ga0496104_0015973 3300048907 Bacteria 6813
84 Ga0496105_0005071 3300048908 Bacteria 9977
85 Ga0496106_0362279 3300048909 Bacteria 1165
86 Ga0496106_0504796 3300048909 Bacteria 971
87 Ga0496107_0306507 3300048910 Bacteria 1182
88 Ga0496108_0051455 3300048911 Bacteria 3451
89 Ga0496108_0207293 3300048911 Bacteria 1701
90 Ga0496109_0078164 3300048912 Bacteria 3046
91 Ga0496110_0010246 3300048913 Bacteria 7614
92 Ga0496110_0131364 3300048913 Bacteria 2261
93 Ga0496111_0044667 3300048914 Bacteria 3185
94 Ga0496122_0009329 3300048925 Bacteria 10365
95 Ga0496125_0001289 3300048928 Bacteria 37162
96 Ga0496125_0012759 3300048928 Bacteria 8308
97 Ga0496125_0077332 3300048928 Bacteria 2566
98 Ga0501037_0211274 3300049573 Bacteria 1368
99 Ga0501043_0001706 3300049579 Bacteria 19026
100 Ga0501198_000021 3300049649 Bacteria 70854
101 Ga0501279_009971 3300049775 Bacteria 1276
102 Ga0501044_0620068 3300049823 Bacteria 973
103 nmdc:mga00v17_25794_c1 3300050491 Bacteria 3419
104 nmdc:mga0k408_255020_c1 3300050493 Bacteria 1047
105 Ga0500568_0035345 3300053139 Bacteria 2039
106 Ga0500573_0084775 3300053140 Bacteria 1797
107 Ga0500590_051243 3300053148 Bacteria 2097
108 Ga0500619_000035 3300053154 Bacteria 41663
109 2643865753 2643221570 Bacteria 5103772
110 2643993041 2643221596 Bacteria 5006805
111 2644294370 2643221652 Bacteria 5140275
112 2644647559 2643221717 Bacteria 5676132
113 2722883468 2721755523 Bacteria 6430384
114 2839139245 2839138175 Bacteria 6549354
115 2842719503 2842718218 Bacteria 4560148
116 2842735928 2842733646 Bacteria 5716726
117 2932425951 2932422444 Bacteria 4678430
118 2990712533 2990710928 Bacteria 5002431
119 Ga0501031_0005853
120 JGI24740J21852_10004444
121 JGI24744J21845_10031715
122 JGI25153J46596_10002394
123 Ga0065714_10220426
124 Ga0065704_10080652
125 Ga0070670_100021534
126 Ga0070673_100355966
127 Ga0070659_100102064
128 Ga0070667_100049896
129 Ga0068853_100491441
130 Ga0070665_100046614
131 Ga0068864_100090614
132 Ga0068870_10095367
133 Ga0068863_100276569
134 Ga0075365_10042953
135 Ga0075364_10027296
136 Ga0097621_100573268
137 Ga0075370_10168169
138 Ga0079104_1000007
139 Ga0105250_10009606
140 Ga0105243_10001726
141 Ga0105239_10819375
142 Ga0157378_10856928
143 Ga0163162_10059086
144 Ga0163163_10290235
145 Ga0157376_10630440
146 Ga0182007_10001576
147 Ga0163161_10035909
148 Ga0213872_10000169
149 Ga0209257_1019008
150 Ga0207696_1043554
151 Ga0207706_10001939
152 Ga0207686_10219497
153 Ga0207709_10000439
154 Ga0207709_10357014
155 Ga0207669_10015881
156 Ga0207651_10153400
157 Ga0207658_10030644
158 Ga0207648_10197840
159 Ga0207683_10009173
160 Ga0207683_10038156
161 Ga0209281_1000020
162 Ga0209995_1006581
163 Ga0209974_10005569
164 Ga0307517_10003097
165 Ga0307515_10048179
166 Ga0307509_10034003
167 Ga0307408_100000538
168 Ga0307508_10023931
169 Ga0307514_10000395
170 Ga0307406_10009203
171 Ga0307412_10201755
172 Ga0307409_100659439
173 Ga0436361_0159126
174 Ga0436361_0413719
175 Ga0439435_0081402
176 Ga0451577_0105493
177 Ga0451577_0190572
178 Ga0453683_0018295
179 Ga0453684_0043427
180 Ga0451576_0007881
181 Ga0451576_0071366
182 Ga0451576_0310112
183 Ga0451576_1201495
184 Ga0495629_0200284
185 Ga0495639_0013615
186 Ga0495620_0091790
187 Ga0495642_0075819
188 Ga0495597_0000153
189 Ga0495633_0005087
190 Ga0495656_0148260
191 Ga0495668_0354131
192 Ga0495657_0083111
193 Ga0495669_0054017
194 Ga0495669_0089597
195 Ga0495613_0294304
196 Ga0495685_033430
197 Ga0496100_0051845
198 Ga0496101_0013958
199 Ga0496102_0013747
200 Ga0496103_0006569
201 Ga0496104_0015973
202 Ga0496105_0005071
203 Ga0496106_0362279
204 Ga0496106_0504796
205 Ga0496107_0306507
206 Ga0496108_0051455
207 Ga0496108_0207293
208 Ga0496109_0078164
209 Ga0496110_0010246
210 Ga0496110_0131364
211 Ga0496111_0044667
212 Ga0496122_0009329
213 Ga0496125_0001289
214 Ga0496125_0012759
215 Ga0496125_0077332
216 Ga0501037_0211274
217 Ga0501043_0001706
218 Ga0501198_000021
219 Ga0501279_009971
220 Ga0501044_0620068
221 nmdc:mga00v17_25794_c1
222 nmdc:mga0k408_255020_c1
223 Ga0500568_0035345
224 Ga0500573_0084775
225 Ga0500590_051243
226 Ga0500619_000035
227 2643865753
228 2643993041
229 2644294370
230 2644647559
231 2722883468
232 2839139245
233 2842719503
234 2842735928
235 2932425951
236 2990712533

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06026

Rib_5-P_isom_A

Ribose 5-phosphate isomerase A (phosphoriboisomerase A)

87

256

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m0s-assembly1.cif.gz_B northeast structural genomics consortium (nesg id ir21) 0.9886 2 210
1ks2-assembly1.cif.gz_B crystal structure analysis of the rpia, structural genomics, protein ec1268. 0.9834 2 212
1o8b-assembly1.cif.gz_B structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. 0.9815 2 211
6mc0-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from legionella pneumophila with bound substrate ribose-5-phosphate and product ribulose-5-phosphate 0.9785 2 209
7lda-assembly1.cif.gz_A crystal structure of a ribose-5-phosphate isomerase from stenotrophomonas maltophilia k279a 0.9783 2 210
ID Description Score Start End Superfamily
4m8lB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9841 118 189 3.30.70.260
4m8lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9729 2 116 3.40.50.1360
4m8lB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9709 118 189 3.30.70.260
1ks2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9583 2 212 3.40.50.1360
4gmkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9542 2 112 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A4Q3HV98-F1-model_v4 deleted 1.002 3 72
AF-A0A4Q3UTI0-F1-model_v4 ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) 0.9989 2 108 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A4Z0CDU1-F1-model_v4 Ribose-5-phosphate isomerase A (EC 5.3.1.6) (Phosphoriboisomerase A) (PRI) 0.998 2 212 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A1WJ80-F1-model_v4 Ribose-5-phosphate isomerase A (EC 5.3.1.6) (Phosphoriboisomerase A) (PRI) 0.9979 2 212 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A2M8E9B3-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9979 11 212 GO:0004751
GO:0005829
GO:0006014
GO:0009052

Map