F098967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 118 | 105 | 236 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0005853|Ga0501031_0005853_2535_3329 |
| Length | 264 |
| Sequence | MGRFGIHAKKQGTGKGVGQRHGDNPNKTNRFSAMTDHTALTQDELKQRVGQAALQYVVPGEILGVGTGSTVNCFIDALATMKARIPGAVSSSEASSARLRALGIAVLDANEVQRLSVYIDGADEIDGHGCMIKGGGAALTREKIVAALADRFICIADASKRVDVLGRFPLPVEVIPMAVAQLTRRFAALGGVATVRLKDGTPLVTDNGQHILDVRGLAIADPLAFETEVSQWPGVVTVGVFAHQRASICLLGTPEGVRTIDFGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 14 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 15 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 16 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 17 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 18 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 20 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 21 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 29 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 31 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 42 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 45 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 46 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 47 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 48 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 49 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 50 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 51 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 52 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 53 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 54 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 55 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 56 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 57 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 58 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 59 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 72 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 73 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 74 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 75 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 76 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 77 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 78 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 79 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 81 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 82 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 83 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 84 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 85 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 86 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 88 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 89 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 90 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 91 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 92 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 93 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 94 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 95 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 96 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 97 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 98 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 99 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 100 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 101 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 102 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 103 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 104 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 105 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.53 |
| Metatranscriptomes | 0 |
| Isolates | 8.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.32 |
| Nodule | 1.69 |
| Rhizoplane | 12.71 |
| Rhizosphere | 62.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0005853 | 3300049568 | Bacteria | 8012 |
| 2 | JGI24740J21852_10004444 | 3300001979 | Bacteria | 6032 |
| 3 | JGI24744J21845_10031715 | 3300002077 | Bacteria | 1009 |
| 4 | JGI25153J46596_10002394 | 3300003215 | Bacteria | 10835 |
| 5 | Ga0065714_10220426 | 3300005288 | Bacteria | 842 |
| 6 | Ga0065704_10080652 | 3300005289 | Bacteria | 3906 |
| 7 | Ga0070670_100021534 | 3300005331 | Bacteria | 5544 |
| 8 | Ga0070673_100355966 | 3300005364 | Bacteria | 1300 |
| 9 | Ga0070659_100102064 | 3300005366 | Bacteria | 2309 |
| 10 | Ga0070667_100049896 | 3300005367 | Bacteria | 3526 |
| 11 | Ga0068853_100491441 | 3300005539 | Bacteria | 1158 |
| 12 | Ga0070665_100046614 | 3300005548 | Bacteria | 4353 |
| 13 | Ga0068864_100090614 | 3300005618 | Bacteria | 2696 |
| 14 | Ga0068870_10095367 | 3300005840 | Bacteria | 1671 |
| 15 | Ga0068863_100276569 | 3300005841 | Bacteria | 1626 |
| 16 | Ga0075365_10042953 | 3300006038 | Bacteria | 2958 |
| 17 | Ga0075364_10027296 | 3300006051 | Bacteria | 3646 |
| 18 | Ga0097621_100573268 | 3300006237 | Bacteria | 1029 |
| 19 | Ga0075370_10168169 | 3300006353 | Bacteria | 1288 |
| 20 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 21 | Ga0105250_10009606 | 3300009092 | Bacteria | 4069 |
| 22 | Ga0105243_10001726 | 3300009148 | Bacteria | 18821 |
| 23 | Ga0105239_10819375 | 3300010375 | Bacteria | 1067 |
| 24 | Ga0157378_10856928 | 3300013297 | Bacteria | 937 |
| 25 | Ga0163162_10059086 | 3300013306 | Bacteria | 3866 |
| 26 | Ga0163163_10290235 | 3300014325 | Bacteria | 1688 |
| 27 | Ga0157376_10630440 | 3300014969 | Bacteria | 1070 |
| 28 | Ga0182007_10001576 | 3300015262 | Bacteria | 12166 |
| 29 | Ga0163161_10035909 | 3300017792 | Bacteria | 3548 |
| 30 | Ga0213872_10000169 | 3300021361 | Bacteria | 58596 |
| 31 | Ga0209257_1019008 | 3300025304 | Bacteria | 2609 |
| 32 | Ga0207696_1043554 | 3300025711 | Bacteria | 1304 |
| 33 | Ga0207706_10001939 | 3300025933 | Bacteria | 20308 |
| 34 | Ga0207686_10219497 | 3300025934 | Bacteria | 1372 |
| 35 | Ga0207709_10000439 | 3300025935 | Bacteria | 39121 |
| 36 | Ga0207709_10357014 | 3300025935 | Bacteria | 1105 |
| 37 | Ga0207669_10015881 | 3300025937 | Bacteria | 3810 |
| 38 | Ga0207651_10153400 | 3300025960 | Bacteria | 1796 |
| 39 | Ga0207658_10030644 | 3300025986 | Bacteria | 3811 |
| 40 | Ga0207648_10197840 | 3300026089 | Bacteria | 1782 |
| 41 | Ga0207683_10009173 | 3300026121 | Bacteria | 8427 |
| 42 | Ga0207683_10038156 | 3300026121 | Bacteria | 4185 |
| 43 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 44 | Ga0209995_1006581 | 3300027471 | Bacteria | 1867 |
| 45 | Ga0209974_10005569 | 3300027876 | Bacteria | 4426 |
| 46 | Ga0307517_10003097 | 3300028786 | Bacteria | 26244 |
| 47 | Ga0307515_10048179 | 3300028794 | Bacteria | 6450 |
| 48 | Ga0307509_10034003 | 3300031507 | Bacteria | 5604 |
| 49 | Ga0307408_100000538 | 3300031548 | Bacteria | 32684 |
| 50 | Ga0307508_10023931 | 3300031616 | Bacteria | 5543 |
| 51 | Ga0307514_10000395 | 3300031649 | Bacteria | 99171 |
| 52 | Ga0307406_10009203 | 3300031901 | Bacteria | 5533 |
| 53 | Ga0307412_10201755 | 3300031911 | Bacteria | 1511 |
| 54 | Ga0307409_100659439 | 3300031995 | Bacteria | 1041 |
| 55 | Ga0436361_0159126 | 3300039447 | Bacteria | 34073 |
| 56 | Ga0436361_0413719 | 3300039447 | Bacteria | 3213 |
| 57 | Ga0439435_0081402 | 3300042436 | Bacteria | 972 |
| 58 | Ga0451577_0105493 | 3300042876 | Bacteria | 2519 |
| 59 | Ga0451577_0190572 | 3300042876 | Bacteria | 1850 |
| 60 | Ga0453683_0018295 | 3300044673 | Bacteria | 4498 |
| 61 | Ga0453684_0043427 | 3300044712 | Bacteria | 6041 |
| 62 | Ga0451576_0007881 | 3300045051 | Bacteria | 12620 |
| 63 | Ga0451576_0071366 | 3300045051 | Bacteria | 3614 |
| 64 | Ga0451576_0310112 | 3300045051 | Bacteria | 1651 |
| 65 | Ga0451576_1201495 | 3300045051 | Bacteria | 792 |
| 66 | Ga0495629_0200284 | 3300046459 | Bacteria | 1381 |
| 67 | Ga0495639_0013615 | 3300046475 | Bacteria | 3516 |
| 68 | Ga0495620_0091790 | 3300046515 | Bacteria | 1218 |
| 69 | Ga0495642_0075819 | 3300046528 | Bacteria | 1411 |
| 70 | Ga0495597_0000153 | 3300046542 | Bacteria | 61233 |
| 71 | Ga0495633_0005087 | 3300046558 | Bacteria | 8171 |
| 72 | Ga0495656_0148260 | 3300046615 | Bacteria | 1131 |
| 73 | Ga0495668_0354131 | 3300046616 | Bacteria | 806 |
| 74 | Ga0495657_0083111 | 3300046675 | Bacteria | 2068 |
| 75 | Ga0495669_0054017 | 3300046684 | Bacteria | 1808 |
| 76 | Ga0495669_0089597 | 3300046684 | Bacteria | 1419 |
| 77 | Ga0495613_0294304 | 3300046689 | Bacteria | 1125 |
| 78 | Ga0495685_033430 | 3300047447 | Bacteria | 1767 |
| 79 | Ga0496100_0051845 | 3300048903 | Bacteria | 2665 |
| 80 | Ga0496101_0013958 | 3300048904 | Bacteria | 5394 |
| 81 | Ga0496102_0013747 | 3300048905 | Bacteria | 7020 |
| 82 | Ga0496103_0006569 | 3300048906 | Bacteria | 6937 |
| 83 | Ga0496104_0015973 | 3300048907 | Bacteria | 6813 |
| 84 | Ga0496105_0005071 | 3300048908 | Bacteria | 9977 |
| 85 | Ga0496106_0362279 | 3300048909 | Bacteria | 1165 |
| 86 | Ga0496106_0504796 | 3300048909 | Bacteria | 971 |
| 87 | Ga0496107_0306507 | 3300048910 | Bacteria | 1182 |
| 88 | Ga0496108_0051455 | 3300048911 | Bacteria | 3451 |
| 89 | Ga0496108_0207293 | 3300048911 | Bacteria | 1701 |
| 90 | Ga0496109_0078164 | 3300048912 | Bacteria | 3046 |
| 91 | Ga0496110_0010246 | 3300048913 | Bacteria | 7614 |
| 92 | Ga0496110_0131364 | 3300048913 | Bacteria | 2261 |
| 93 | Ga0496111_0044667 | 3300048914 | Bacteria | 3185 |
| 94 | Ga0496122_0009329 | 3300048925 | Bacteria | 10365 |
| 95 | Ga0496125_0001289 | 3300048928 | Bacteria | 37162 |
| 96 | Ga0496125_0012759 | 3300048928 | Bacteria | 8308 |
| 97 | Ga0496125_0077332 | 3300048928 | Bacteria | 2566 |
| 98 | Ga0501037_0211274 | 3300049573 | Bacteria | 1368 |
| 99 | Ga0501043_0001706 | 3300049579 | Bacteria | 19026 |
| 100 | Ga0501198_000021 | 3300049649 | Bacteria | 70854 |
| 101 | Ga0501279_009971 | 3300049775 | Bacteria | 1276 |
| 102 | Ga0501044_0620068 | 3300049823 | Bacteria | 973 |
| 103 | nmdc:mga00v17_25794_c1 | 3300050491 | Bacteria | 3419 |
| 104 | nmdc:mga0k408_255020_c1 | 3300050493 | Bacteria | 1047 |
| 105 | Ga0500568_0035345 | 3300053139 | Bacteria | 2039 |
| 106 | Ga0500573_0084775 | 3300053140 | Bacteria | 1797 |
| 107 | Ga0500590_051243 | 3300053148 | Bacteria | 2097 |
| 108 | Ga0500619_000035 | 3300053154 | Bacteria | 41663 |
| 109 | 2643865753 | 2643221570 | Bacteria | 5103772 |
| 110 | 2643993041 | 2643221596 | Bacteria | 5006805 |
| 111 | 2644294370 | 2643221652 | Bacteria | 5140275 |
| 112 | 2644647559 | 2643221717 | Bacteria | 5676132 |
| 113 | 2722883468 | 2721755523 | Bacteria | 6430384 |
| 114 | 2839139245 | 2839138175 | Bacteria | 6549354 |
| 115 | 2842719503 | 2842718218 | Bacteria | 4560148 |
| 116 | 2842735928 | 2842733646 | Bacteria | 5716726 |
| 117 | 2932425951 | 2932422444 | Bacteria | 4678430 |
| 118 | 2990712533 | 2990710928 | Bacteria | 5002431 |
| 119 | Ga0501031_0005853 | |||
| 120 | JGI24740J21852_10004444 | |||
| 121 | JGI24744J21845_10031715 | |||
| 122 | JGI25153J46596_10002394 | |||
| 123 | Ga0065714_10220426 | |||
| 124 | Ga0065704_10080652 | |||
| 125 | Ga0070670_100021534 | |||
| 126 | Ga0070673_100355966 | |||
| 127 | Ga0070659_100102064 | |||
| 128 | Ga0070667_100049896 | |||
| 129 | Ga0068853_100491441 | |||
| 130 | Ga0070665_100046614 | |||
| 131 | Ga0068864_100090614 | |||
| 132 | Ga0068870_10095367 | |||
| 133 | Ga0068863_100276569 | |||
| 134 | Ga0075365_10042953 | |||
| 135 | Ga0075364_10027296 | |||
| 136 | Ga0097621_100573268 | |||
| 137 | Ga0075370_10168169 | |||
| 138 | Ga0079104_1000007 | |||
| 139 | Ga0105250_10009606 | |||
| 140 | Ga0105243_10001726 | |||
| 141 | Ga0105239_10819375 | |||
| 142 | Ga0157378_10856928 | |||
| 143 | Ga0163162_10059086 | |||
| 144 | Ga0163163_10290235 | |||
| 145 | Ga0157376_10630440 | |||
| 146 | Ga0182007_10001576 | |||
| 147 | Ga0163161_10035909 | |||
| 148 | Ga0213872_10000169 | |||
| 149 | Ga0209257_1019008 | |||
| 150 | Ga0207696_1043554 | |||
| 151 | Ga0207706_10001939 | |||
| 152 | Ga0207686_10219497 | |||
| 153 | Ga0207709_10000439 | |||
| 154 | Ga0207709_10357014 | |||
| 155 | Ga0207669_10015881 | |||
| 156 | Ga0207651_10153400 | |||
| 157 | Ga0207658_10030644 | |||
| 158 | Ga0207648_10197840 | |||
| 159 | Ga0207683_10009173 | |||
| 160 | Ga0207683_10038156 | |||
| 161 | Ga0209281_1000020 | |||
| 162 | Ga0209995_1006581 | |||
| 163 | Ga0209974_10005569 | |||
| 164 | Ga0307517_10003097 | |||
| 165 | Ga0307515_10048179 | |||
| 166 | Ga0307509_10034003 | |||
| 167 | Ga0307408_100000538 | |||
| 168 | Ga0307508_10023931 | |||
| 169 | Ga0307514_10000395 | |||
| 170 | Ga0307406_10009203 | |||
| 171 | Ga0307412_10201755 | |||
| 172 | Ga0307409_100659439 | |||
| 173 | Ga0436361_0159126 | |||
| 174 | Ga0436361_0413719 | |||
| 175 | Ga0439435_0081402 | |||
| 176 | Ga0451577_0105493 | |||
| 177 | Ga0451577_0190572 | |||
| 178 | Ga0453683_0018295 | |||
| 179 | Ga0453684_0043427 | |||
| 180 | Ga0451576_0007881 | |||
| 181 | Ga0451576_0071366 | |||
| 182 | Ga0451576_0310112 | |||
| 183 | Ga0451576_1201495 | |||
| 184 | Ga0495629_0200284 | |||
| 185 | Ga0495639_0013615 | |||
| 186 | Ga0495620_0091790 | |||
| 187 | Ga0495642_0075819 | |||
| 188 | Ga0495597_0000153 | |||
| 189 | Ga0495633_0005087 | |||
| 190 | Ga0495656_0148260 | |||
| 191 | Ga0495668_0354131 | |||
| 192 | Ga0495657_0083111 | |||
| 193 | Ga0495669_0054017 | |||
| 194 | Ga0495669_0089597 | |||
| 195 | Ga0495613_0294304 | |||
| 196 | Ga0495685_033430 | |||
| 197 | Ga0496100_0051845 | |||
| 198 | Ga0496101_0013958 | |||
| 199 | Ga0496102_0013747 | |||
| 200 | Ga0496103_0006569 | |||
| 201 | Ga0496104_0015973 | |||
| 202 | Ga0496105_0005071 | |||
| 203 | Ga0496106_0362279 | |||
| 204 | Ga0496106_0504796 | |||
| 205 | Ga0496107_0306507 | |||
| 206 | Ga0496108_0051455 | |||
| 207 | Ga0496108_0207293 | |||
| 208 | Ga0496109_0078164 | |||
| 209 | Ga0496110_0010246 | |||
| 210 | Ga0496110_0131364 | |||
| 211 | Ga0496111_0044667 | |||
| 212 | Ga0496122_0009329 | |||
| 213 | Ga0496125_0001289 | |||
| 214 | Ga0496125_0012759 | |||
| 215 | Ga0496125_0077332 | |||
| 216 | Ga0501037_0211274 | |||
| 217 | Ga0501043_0001706 | |||
| 218 | Ga0501198_000021 | |||
| 219 | Ga0501279_009971 | |||
| 220 | Ga0501044_0620068 | |||
| 221 | nmdc:mga00v17_25794_c1 | |||
| 222 | nmdc:mga0k408_255020_c1 | |||
| 223 | Ga0500568_0035345 | |||
| 224 | Ga0500573_0084775 | |||
| 225 | Ga0500590_051243 | |||
| 226 | Ga0500619_000035 | |||
| 227 | 2643865753 | |||
| 228 | 2643993041 | |||
| 229 | 2644294370 | |||
| 230 | 2644647559 | |||
| 231 | 2722883468 | |||
| 232 | 2839139245 | |||
| 233 | 2842719503 | |||
| 234 | 2842735928 | |||
| 235 | 2932425951 | |||
| 236 | 2990712533 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m0s-assembly1.cif.gz_B | northeast structural genomics consortium (nesg id ir21) | 0.9886 | 2 | 210 |
| 1ks2-assembly1.cif.gz_B | crystal structure analysis of the rpia, structural genomics, protein ec1268. | 0.9834 | 2 | 212 |
| 1o8b-assembly1.cif.gz_B | structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. | 0.9815 | 2 | 211 |
| 6mc0-assembly1.cif.gz_B | crystal structure of ribose-5-phosphate isomerase from legionella pneumophila with bound substrate ribose-5-phosphate and product ribulose-5-phosphate | 0.9785 | 2 | 209 |
| 7lda-assembly1.cif.gz_A | crystal structure of a ribose-5-phosphate isomerase from stenotrophomonas maltophilia k279a | 0.9783 | 2 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4m8lB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9841 | 118 | 189 | 3.30.70.260 |
| 4m8lA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9729 | 2 | 116 | 3.40.50.1360 |
| 4m8lB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9709 | 118 | 189 | 3.30.70.260 |
| 1ks2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9583 | 2 | 212 | 3.40.50.1360 |
| 4gmkB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9542 | 2 | 112 | 3.40.50.1360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3HV98-F1-model_v4 | deleted | 1.002 | 3 | 72 |
|
| AF-A0A4Q3UTI0-F1-model_v4 | ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) | 0.9989 | 2 | 108 |
GO:0004751
GO:0005829 GO:0006014 GO:0009052 |
| AF-A0A4Z0CDU1-F1-model_v4 | Ribose-5-phosphate isomerase A (EC 5.3.1.6) (Phosphoriboisomerase A) (PRI) | 0.998 | 2 | 212 |
GO:0004751
GO:0005829 GO:0006014 GO:0009052 |
| AF-A1WJ80-F1-model_v4 | Ribose-5-phosphate isomerase A (EC 5.3.1.6) (Phosphoriboisomerase A) (PRI) | 0.9979 | 2 | 212 |
GO:0004751
GO:0005829 GO:0006014 GO:0009052 |
| AF-A0A2M8E9B3-F1-model_v4 | Ribose 5-phosphate isomerase A (EC 5.3.1.6) | 0.9979 | 11 | 212 |
GO:0004751
GO:0005829 GO:0006014 GO:0009052 |