F093625

General Info

Members Datasets Scaffolds Average Seq Length
117 83 116 286

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100246743|Ga0307416_1002467432
Length 324
Sequence MRRPPPHVYFLVSAVFHYLGPAFAVLLFARVDVLGVAWLRIASAALVFAIWRRPWRAVGRLDRDGRRLLLAWGAVLAAMNCCFYLAIDRLPLGTVAAIEFLPVIALAALGARTPRNAVALALAAPGVPLLTGVHVGDEALALAXAGANAALFALYIVLADRVAKHGETLTGVDGLGASMLVAAVVVTPMAGWAAVPALGDPVALLAGVGVGLCSSVIPYVADQLALARLPRATYALMVALLPATATVIGIVVLTQVPEPAEVAGIALIVAGVALHRPAPAEPQRKGMRMTRSSSSEGSPRPSRLLVVSQSAPSGPSATGMRHSR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
83 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 6.84
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009094 3300001979 Bacteria 3907
2 JGI24739J22299_10034390 3300001989 Unclassified 1727
3 JGI24737J22298_10011026 3300001990 Bacteria 2968
4 JGI25406J46586_10002356 3300003203 Bacteria 8933
5 JGI25407J50210_10000538 3300003373 Bacteria 7615
6 Ga0070658_10243104 3300005327 Bacteria 1526
7 Ga0070682_100022680 3300005337 Bacteria 3720
8 Ga0070682_100126088 3300005337 Bacteria 1726
9 Ga0070682_100132066 3300005337 Unclassified 1691
10 Ga0068868_100209388 3300005338 Bacteria 1629
11 Ga0070700_100119803 3300005441 Bacteria 1762
12 Ga0070679_100106491 3300005530 Bacteria 2790
13 Ga0070684_100044438 3300005535 Bacteria 3843
14 Ga0070684_100239355 3300005535 Bacteria 1658
15 Ga0068857_100113813 3300005577 Bacteria 2433
16 Ga0068856_100086881 3300005614 Bacteria 3108
17 Ga0068859_100197356 3300005617 Bacteria 2097
18 Ga0068864_100001913 3300005618 Bacteria 17093
19 Ga0068863_100081504 3300005841 Bacteria 3065
20 Ga0068862_100075860 3300005844 Bacteria 2909
21 Ga0081455_10033852 3300005937 Bacteria 4585
22 Ga0081538_10000363 3300005981 Bacteria 51672
23 Ga0081538_10000454 3300005981 Bacteria 46044
24 Ga0081539_10016526 3300005985 Bacteria 5258
25 Ga0081539_10032680 3300005985 Bacteria 3183
26 Ga0075428_100132311 3300006844 Bacteria 2713
27 Ga0075431_100423167 3300006847 Bacteria 1331
28 Ga0075429_100184345 3300006880 Bacteria 1829
29 Ga0097620_100197368 3300006931 Bacteria 2097
30 Ga0111539_10002980 3300009094 Bacteria 22456
31 Ga0105242_10039533 3300009176 Bacteria 3797
32 Ga0105248_10025854 3300009177 Bacteria 6529
33 Ga0157372_10094524 3300013307 Bacteria 3404
34 Ga0157375_10036370 3300013308 Bacteria 4710
35 Ga0157375_10462287 3300013308 Bacteria 1434
36 Ga0163163_10001908 3300014325 Bacteria 17632
37 Ga0157379_10252575 3300014968 Bacteria 1601
38 Ga0207705_10252592 3300025909 Bacteria 1345
39 Ga0207660_10053034 3300025917 Bacteria 2889
40 Ga0207652_10023964 3300025921 Bacteria 5062
41 Ga0207689_10116899 3300025942 Bacteria 2192
42 Ga0207661_10015390 3300025944 Bacteria 5628
43 Ga0207679_10278328 3300025945 Bacteria 1434
44 Ga0207703_10227073 3300026035 Bacteria 1672
45 Ga0207678_10031159 3300026067 Bacteria 4652
46 Ga0207708_10140274 3300026075 Bacteria 1895
47 Ga0207641_10047222 3300026088 Bacteria 3630
48 Ga0207675_100258038 3300026118 Bacteria 1688
49 Ga0207683_10044013 3300026121 Bacteria 3902
50 Ga0207683_10377341 3300026121 Bacteria 1303
51 Ga0268266_10013265 3300028379 Bacteria 7102
52 Ga0265316_10223298 3300031344 Bacteria 1389
53 Ga0307513_10000037 3300031456 Bacteria 175364
54 Ga0307513_10047114 3300031456 Bacteria 4692
55 Ga0307405_10026849 3300031731 Bacteria 3329
56 Ga0307405_10283834 3300031731 Bacteria 1248
57 Ga0307413_10006892 3300031824 Bacteria 5229
58 Ga0307413_10006974 3300031824 Bacteria 5207
59 Ga0307410_10004826 3300031852 Bacteria 7041
60 Ga0307410_10096765 3300031852 Bacteria 2108
61 Ga0307410_10175356 3300031852 Bacteria 1619
62 Ga0307410_10393952 3300031852 Bacteria 1117
63 Ga0307406_10008795 3300031901 Bacteria 5645
64 Ga0307406_10126765 3300031901 Bacteria 1785
65 Ga0307407_10133289 3300031903 Bacteria 1593
66 Ga0307409_100014363 3300031995 Bacteria 5148
67 Ga0307409_100116274 3300031995 Bacteria 2254
68 Ga0307409_100160077 3300031995 Bacteria 1968
69 Ga0307416_100054937 3300032002 Bacteria 3204
70 Ga0307416_100125330 3300032002 Bacteria 2300
71 Ga0307416_100159787 3300032002 Bacteria 2081
72 Ga0307416_100246743 3300032002 Bacteria 1735
73 Ga0307416_100278806 3300032002 Bacteria 1647
74 Ga0307411_10168736 3300032005 Bacteria 1648
75 Ga0307415_100447676 3300032126 Bacteria 1116
76 Ga0373947_0346670 3300035725 Bacteria 996
77 Ga0395899_0038982 3300037312 Bacteria 3558
78 Ga0395900_0002058 3300037418 Bacteria 22562
79 Ga0395900_0011472 3300037418 Bacteria 9071
80 Ga0395900_0025075 3300037418 Bacteria 6104
81 Ga0395898_0013556 3300037466 Bacteria 8391
82 Ga0395898_0493703 3300037466 Bacteria 1164
83 Ga0395905_0013633 3300037471 Bacteria 7787
84 Ga0395901_0009347 3300038443 Bacteria 9941
85 Ga0395901_0027800 3300038443 Bacteria 5816
86 Ga0395901_0078735 3300038443 Bacteria 3441
87 Ga0395901_0432550 3300038443 Bacteria 1348
88 Ga0395901_0657255 3300038443 Bacteria 1051
89 Ga0466972_0087993 3300044658 Bacteria 1475
90 Ga0466965_0113731 3300044683 Bacteria 1393
91 Ga0466967_0024956 3300045976 Bacteria 4922
92 Ga0466967_0132316 3300045976 Bacteria 2317
93 Ga0466967_0265050 3300045976 Bacteria 1644
94 Ga0466967_0277396 3300045976 Bacteria 1608
95 Ga0495627_040860 3300046453 Bacteria 1427
96 Ga0495609_0134017 3300046538 Bacteria 1060
97 Ga0495615_0002599 3300048090 Bacteria 2915
98 Ga0496101_0088352 3300048904 Bacteria 2302
99 Ga0496104_0051966 3300048907 Bacteria 3870
100 Ga0496108_0267784 3300048911 Bacteria 1487
101 Ga0496108_0359125 3300048911 Bacteria 1271
102 Ga0496109_0003758 3300048912 Bacteria 12686
103 Ga0496110_0052049 3300048913 Bacteria 3599
104 Ga0496111_0071032 3300048914 Bacteria 2533
105 Ga0496112_0269270 3300048915 Bacteria 1652
106 Ga0501046_0343700 3300049580 Bacteria 1084
107 Ga0501079_0208857 3300049741 Bacteria 1525
108 Ga0501080_0014511 3300049742 Bacteria 7258
109 Ga0501045_0108445 3300049824 Bacteria 2058
110 nmdc:mga09592_241096_c1 3300050508 Bacteria 1566
111 nmdc:mga06r32_328919_c1 3300050510 Bacteria 1513
112 nmdc:mga06r32_55831_c1 3300050510 Bacteria 3789
113 nmdc:mga08y16_24382_c1 3300050511 Bacteria 6384
114 nmdc:mga08y16_751119_c1 3300050511 Bacteria 971
115 Ga0500645_003559 3300053730 Bacteria 6270
116 Ga0500645_022189 3300053730 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8033684223 8033686012 235
2 3300044658 Ga0466972_0087993 Ga0466972_0087993_335_1192 238
3 3300005937 Ga0081455_10033852 Ga0081455_100338523 242
4 3300048904 Ga0496101_0088352 Ga0496101_0088352_113_1150 244
5 3300049580 Ga0501046_0343700 Ga0501046_0343700_63_1010 245
6 3300053730 Ga0500645_003559 Ga0500645_003559_3726_4616 247
7 3300006844 Ga0075428_100132311 Ga0075428_1001323114 249
8 3300006847 Ga0075431_100423167 Ga0075431_1004231672 249
9 3300009094 Ga0111539_10002980 Ga0111539_1000298018 249
10 3300050510 nmdc:mga06r32_328919_c1 nmdc:mga06r32_328919_c1_280_1164 249
11 3300050511 nmdc:mga08y16_24382_c1 nmdc:mga08y16_24382_c1_1502_2386 249
12 3300044683 Ga0466965_0113731 Ga0466965_0113731_103_1050 250
13 3300045976 Ga0466967_0277396 Ga0466967_0277396_264_1211 250
14 3300005530 Ga0070679_100106491 Ga0070679_1001064913 254
15 3300005535 Ga0070684_100044438 Ga0070684_1000444384 254
16 3300025917 Ga0207660_10053034 Ga0207660_100530344 254
17 3300025921 Ga0207652_10023964 Ga0207652_100239643 254
18 3300025944 Ga0207661_10015390 Ga0207661_100153905 254
19 3300031456 Ga0307513_10000037 Ga0307513_1000003756 255
20 3300053730 Ga0500645_022189 Ga0500645_022189_916_1806 255
21 3300046538 Ga0495609_0134017 Ga0495609_0134017_49_1026 256
22 3300026118 Ga0207675_100258038 Ga0207675_1002580382 257
23 3300032002 Ga0307416_100278806 Ga0307416_1002788062 258
24 3300037418 Ga0395900_0025075 Ga0395900_0025075_5176_6045 259
25 3300037466 Ga0395898_0493703 Ga0395898_0493703_21_890 259
26 3300038443 Ga0395901_0009347 Ga0395901_0009347_6443_7312 259
27 3300038443 Ga0395901_0657255 Ga0395901_0657255_22_927 259
28 3300031852 Ga0307410_10393952 Ga0307410_103939522 260
29 3300032002 Ga0307416_100054937 Ga0307416_1000549371 260
30 3300037312 Ga0395899_0038982 Ga0395899_0038982_594_1511 262
31 3300037418 Ga0395900_0002058 Ga0395900_0002058_922_1839 262
32 3300038443 Ga0395901_0027800 Ga0395901_0027800_4887_5804 262
33 3300003373 JGI25407J50210_10000538 JGI25407J50210_100005382 264
34 3300005441 Ga0070700_100119803 Ga0070700_1001198031 264
35 3300005535 Ga0070684_100239355 Ga0070684_1002393552 264
36 3300005577 Ga0068857_100113813 Ga0068857_1001138132 264
37 3300005614 Ga0068856_100086881 Ga0068856_1000868812 264
38 3300005617 Ga0068859_100197356 Ga0068859_1001973563 264
39 3300005618 Ga0068864_100001913 Ga0068864_1000019134 264
40 3300005841 Ga0068863_100081504 Ga0068863_1000815043 264
41 3300005981 Ga0081538_10000363 Ga0081538_1000036347 264
42 3300006931 Ga0097620_100197368 Ga0097620_1001973683 264
43 3300009176 Ga0105242_10039533 Ga0105242_100395335 264
44 3300013308 Ga0157375_10036370 Ga0157375_100363706 264
45 3300025945 Ga0207679_10278328 Ga0207679_102783281 264
46 3300026088 Ga0207641_10047222 Ga0207641_100472222 264
47 3300048911 Ga0496108_0359125 Ga0496108_0359125_434_1258 264
48 3300005337 Ga0070682_100022680 Ga0070682_1000226804 267
49 3300013308 Ga0157375_10462287 Ga0157375_104622872 267
50 3300026035 Ga0207703_10227073 Ga0207703_102270732 267
51 3300026067 Ga0207678_10031159 Ga0207678_100311597 267
52 3300026121 Ga0207683_10377341 Ga0207683_103773411 267
53 3300031901 Ga0307406_10008795 Ga0307406_100087954 267
54 3300031995 Ga0307409_100014363 Ga0307409_1000143633 267
55 3300032002 Ga0307416_100159787 Ga0307416_1001597872 267
56 3300049824 Ga0501045_0108445 Ga0501045_0108445_126_1064 267
57 3300050511 nmdc:mga08y16_751119_c1 nmdc:mga08y16_751119_c1_81_944 267
58 3300037418 Ga0395900_0011472 Ga0395900_0011472_5237_6091 268
59 3300037466 Ga0395898_0013556 Ga0395898_0013556_6095_6949 268
60 3300037471 Ga0395905_0013633 Ga0395905_0013633_5281_6135 268
61 3300048907 Ga0496104_0051966 Ga0496104_0051966_2304_3212 268
62 3300032126 Ga0307415_100447676 Ga0307415_1004476762 269
63 3300045976 Ga0466967_0132316 Ga0466967_0132316_1293_2249 269
64 3300026121 Ga0207683_10044013 Ga0207683_100440133 270
65 3300048911 Ga0496108_0267784 Ga0496108_0267784_418_1299 271
66 3300049741 Ga0501079_0208857 Ga0501079_0208857_629_1465 271
67 3300049742 Ga0501080_0014511 Ga0501080_0014511_4876_5712 271
68 3300032002 Ga0307416_100125330 Ga0307416_1001253302 272
69 3300014968 Ga0157379_10252575 Ga0157379_102525751 273
70 3300031731 Ga0307405_10283834 Ga0307405_102838341 273
71 3300031852 Ga0307410_10096765 Ga0307410_100967651 273
72 3300031852 Ga0307410_10175356 Ga0307410_101753562 273
73 3300031903 Ga0307407_10133289 Ga0307407_101332892 273
74 3300031995 Ga0307409_100116274 Ga0307409_1001162742 273
75 3300045976 Ga0466967_0024956 Ga0466967_0024956_1159_1995 274
76 3300038443 Ga0395901_0078735 Ga0395901_0078735_862_1695 275
77 3300038443 Ga0395901_0432550 Ga0395901_0432550_352_1245 275
78 3300005338 Ga0068868_100209388 Ga0068868_1002093882 276
79 3300006880 Ga0075429_100184345 Ga0075429_1001843452 277
80 3300031731 Ga0307405_10026849 Ga0307405_100268494 277
81 3300031824 Ga0307413_10006892 Ga0307413_100068922 277
82 3300031824 Ga0307413_10006974 Ga0307413_100069743 277
83 3300031852 Ga0307410_10004826 Ga0307410_100048263 277
84 3300031901 Ga0307406_10126765 Ga0307406_101267653 277
85 3300032005 Ga0307411_10168736 Ga0307411_101687362 277
86 3300035725 Ga0373947_0346670 Ga0373947_0346670_47_952 277
87 3300050508 nmdc:mga09592_241096_c1 nmdc:mga09592_241096_c1_450_1415 277
88 3300050510 nmdc:mga06r32_55831_c1 nmdc:mga06r32_55831_c1_441_1406 277
89 3300025942 Ga0207689_10116899 Ga0207689_101168993 278
90 3300031456 Ga0307513_10047114 Ga0307513_100471147 278
91 3300032002 Ga0307416_100246743 Ga0307416_1002467432 278
92 3300045976 Ga0466967_0265050 Ga0466967_0265050_242_1162 278
93 3300001979 JGI24740J21852_10009094 JGI24740J21852_100090943 279
94 3300001989 JGI24739J22299_10034390 JGI24739J22299_100343902 279
95 3300001990 JGI24737J22298_10011026 JGI24737J22298_100110262 279
96 3300003203 JGI25406J46586_10002356 JGI25406J46586_100023565 279
97 3300005327 Ga0070658_10243104 Ga0070658_102431041 279
98 3300005337 Ga0070682_100126088 Ga0070682_1001260882 279
99 3300005337 Ga0070682_100132066 Ga0070682_1001320662 279
100 3300005844 Ga0068862_100075860 Ga0068862_1000758604 279
101 3300005981 Ga0081538_10000454 Ga0081538_1000045444 279
102 3300005985 Ga0081539_10016526 Ga0081539_100165265 279
103 3300005985 Ga0081539_10032680 Ga0081539_100326802 279
104 3300009177 Ga0105248_10025854 Ga0105248_100258544 279
105 3300013307 Ga0157372_10094524 Ga0157372_100945244 279
106 3300014325 Ga0163163_10001908 Ga0163163_1000190815 279
107 3300025909 Ga0207705_10252592 Ga0207705_102525921 279
108 3300026075 Ga0207708_10140274 Ga0207708_101402742 279
109 3300028379 Ga0268266_10013265 Ga0268266_100132654 279
110 3300031344 Ga0265316_10223298 Ga0265316_102232981 279
111 3300031995 Ga0307409_100160077 Ga0307409_1001600772 279
112 3300046453 Ga0495627_040860 Ga0495627_040860_492_1367 279
113 3300048090 Ga0495615_0002599 Ga0495615_0002599_668_1552 279
114 3300048912 Ga0496109_0003758 Ga0496109_0003758_8002_8979 279
115 3300048913 Ga0496110_0052049 Ga0496110_0052049_67_1044 279
116 3300048914 Ga0496111_0071032 Ga0496111_0071032_1486_2463 279
117 3300048915 Ga0496112_0269270 Ga0496112_0269270_112_1047 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

140

275

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.7861 9 274
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7791 9 274
7b0k-assembly1.cif.gz_A membrane protein structure 0.7696 9 274
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7464 9 274
5i20-assembly1.cif.gz_A crystal structure of protein 0.7396 8 274
ID Description Score Start End Superfamily
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6383 7 274 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6169 7 274 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6037 10 274 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.579 10 274 1.20.1740.10
af_G5EDA7_98_520_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4258 60 221 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A503BA72-F1-model_v4 DMT family transporter 0.9745 2 279 GO:0016020
AF-A0A502YGQ4-F1-model_v4 deleted 0.9725 1 279
AF-A0A436K782-F1-model_v4 deleted 0.972 2 279
AF-A0A442HNW3-F1-model_v4 DMT family transporter 0.9709 2 279 GO:0016020
AF-A0A435XGB1-F1-model_v4 DMT family transporter 0.9704 10 279 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map