F093601

General Info

Members Datasets Scaffolds Average Seq Length
117 93 234 296

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10058677|Ga0307406_100586772
Length 321
Sequence MVHPPRTPKRWQDGEVIVYACPGQGSQTPGFLSPWLELDGVAEQLAAYSEAAEVDLLLHGTESDADTIRDTRIAQPLIVAASLIAERQLLERAGRRPDGIAGHSVGELAALAGAGVISADTAMRLVGVRGRAMADAAAQTPTGMSAVLGGDEDAVLARLAELDLTPANYNGGGQIVAAGALPALAALAEEPLRGTRVIPLQVAGAFHTPYMAPAVAALRDAVAGVEASDPDVTLWTNRDGSTVSDGATALNFLVDQVSSPVRWDLCMASFAEQGITGLVELTPAGALVGLAKRGLRGVPTVAVKTPEDLDAAVALLNGDAA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
12 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
13 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
16 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
17 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
18 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
19 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
20 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
21 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
22 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
23 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
24 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
25 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
26 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
27 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
28 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
29 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
30 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
31 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
32 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
35 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
36 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
37 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
38 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
39 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
40 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
41 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
45 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
49 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
50 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
52 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
53 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
54 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
55 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
56 2643221546 Microbacterium sp. Root53 Isolate Unclassified
57 2643221553 Microbacterium sp. Root553 Isolate Unclassified
58 2643221566 Microbacterium sp. Root166 Isolate Unclassified
59 2643221575 Microbacterium sp. Root61 Isolate Unclassified
60 2643221597 Microbacterium sp. Root180 Isolate Unclassified
61 2643221630 Microbacterium sp. Root322 Isolate Unclassified
62 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
63 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
64 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
65 2773857759 Microbacterium sp. 1294 Isolate Unclassified
66 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
67 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
68 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
69 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
70 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
71 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
72 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
73 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
74 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
75 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
76 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
77 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
78 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
79 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
80 2919395869 Microbacterium resistens 2980 Isolate Unclassified
81 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
82 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
83 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
84 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
85 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
86 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
87 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
88 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
89 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
90 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
91 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
92 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
93 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 66.67
Metatranscriptomes 0
Isolates 33.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 3.42
Rhizosphere 45.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10058677 3300031901 Bacteria 2474
2 JGI24740J21852_10019274 3300001979 Bacteria 2406
3 JGI25154J39366_1004807 3300002738 Bacteria 2307
4 Ga0075365_10007174 3300006038 Bacteria 6221
5 Ga0075368_10004765 3300006042 Bacteria 4620
6 Ga0075363_100085349 3300006048 Bacteria 1732
7 Ga0075364_10131990 3300006051 Bacteria 1677
8 Ga0075369_10047495 3300006186 Bacteria 1851
9 Ga0157371_10001820 3300013102 Bacteria 21485
10 Ga0157369_10087698 3300013105 Bacteria 3322
11 Ga0157375_10297847 3300013308 Bacteria 1776
12 Ga0209646_1000167 3300025246 Bacteria 87036
13 Ga0207647_10015346 3300025904 Bacteria 5254
14 Ga0207639_10280648 3300026041 Bacteria 1465
15 Ga0307405_10009047 3300031731 Bacteria 5088
16 Ga0307413_10160217 3300031824 Bacteria 1580
17 Ga0307410_10071860 3300031852 Bacteria 2401
18 Ga0307406_10000123 3300031901 Bacteria 45640
19 Ga0307406_10000602 3300031901 Bacteria 20583
20 Ga0307406_10102593 3300031901 Bacteria 1952
21 Ga0307407_10130179 3300031903 Bacteria 1609
22 Ga0307409_100016562 3300031995 Bacteria 4881
23 Ga0307409_100533763 3300031995 Bacteria 1149
24 Ga0307414_10091136 3300032004 Bacteria 2265
25 Ga0307415_100208749 3300032126 Bacteria 1556
26 Ga0307415_100265168 3300032126 Bacteria 1404
27 Ga0395898_0444589 3300037466 Bacteria 1235
28 Ga0451837_1799248 3300041494 Bacteria 1025
29 Ga0466965_0071208 3300044683 Bacteria 1748
30 Ga0466970_0000428 3300044765 Bacteria 20583
31 Ga0466970_0069510 3300044765 Bacteria 1893
32 Ga0495627_000742 3300046453 Bacteria 24523
33 Ga0495620_0048646 3300046515 Bacteria 1819
34 Ga0495645_0007535 3300046543 Bacteria 7571
35 Ga0496105_0220487 3300048908 Bacteria 1544
36 Ga0496114_0040447 3300048917 Bacteria 3860
37 Ga0496114_0154200 3300048917 Bacteria 1994
38 Ga0496115_0060424 3300048918 Bacteria 3054
39 Ga0496116_0112648 3300048919 Bacteria 1594
40 Ga0496118_0015248 3300048921 Bacteria 7128
41 Ga0496119_0002232 3300048922 Bacteria 21580
42 Ga0496119_0008633 3300048922 Bacteria 8918
43 Ga0496120_0002279 3300048923 Bacteria 19926
44 Ga0496122_0000030 3300048925 Bacteria 331586
45 Ga0496122_0017802 3300048925 Bacteria 6608
46 Ga0496122_0026081 3300048925 Bacteria 5054
47 Ga0496122_0062031 3300048925 Bacteria 2739
48 Ga0496123_0000024 3300048926 Bacteria 331587
49 Ga0496123_0030146 3300048926 Bacteria 3976
50 Ga0496124_0011174 3300048927 Bacteria 9003
51 Ga0496124_0071521 3300048927 Bacteria 2875
52 Ga0496124_0253841 3300048927 Bacteria 1299
53 Ga0496125_0000061 3300048928 Bacteria 262739
54 Ga0496125_0003349 3300048928 Bacteria 19512
55 Ga0496125_0015344 3300048928 Bacteria 7416
56 Ga0496125_0019154 3300048928 Bacteria 6469
57 Ga0496125_0072128 3300048928 Bacteria 2693
58 Ga0496125_0080008 3300048928 Bacteria 2503
59 Ga0496126_0004143 3300048929 Bacteria 17528
60 Ga0496126_0019540 3300048929 Bacteria 6669
61 Ga0496126_0121254 3300048929 Bacteria 2267
62 Ga0496126_0155188 3300048929 Bacteria 1960
63 Ga0501033_0109161 3300049570 Bacteria 2015
64 Ga0501034_0039896 3300049571 Bacteria 4755
65 Ga0501036_0131357 3300049572 Bacteria 2114
66 Ga0501038_0005618 3300049574 Bacteria 11639
67 Ga0501038_0085660 3300049574 Bacteria 2649
68 Ga0501039_0040308 3300049575 Bacteria 3605
69 Ga0501042_0003755 3300049578 Bacteria 9595
70 Ga0501046_0084810 3300049580 Bacteria 2443
71 Ga0501069_0230514 3300049585 Bacteria 1078
72 Ga0501070_0000716 3300049586 Bacteria 30296
73 Ga0501035_0051121 3300049822 Bacteria 3702
74 Ga0501044_0372395 3300049823 Bacteria 1344
75 nmdc:mga00v17_3671_c1 3300050491 Bacteria 7930
76 nmdc:mga00v17_45654_c1 3300050491 Bacteria 2648
77 nmdc:mga0yw44_2472_c1 3300050492 Bacteria 7894
78 nmdc:mga0sz30_54482_c1 3300050516 Bacteria 1701
79 2643733562 2643221542 Bacteria 3563959
80 2643752283 2643221546 Bacteria 2910897
81 2643785943 2643221553 Bacteria 3544260
82 2643848289 2643221566 Bacteria 3460379
83 2643885430 2643221575 Bacteria 4022601
84 2643995727 2643221597 Bacteria 3347721
85 2644170137 2643221630 Bacteria 3601215
86 2644680356 2643221724 Bacteria 3593515
87 2730229809 2728369380 Bacteria 3620317
88 2747952028 2747842429 Bacteria 3914386
89 2774384523 2773857759 Bacteria 2963774
90 2774399533 2773857763 Bacteria 4180068
91 2808631183 2808606306 Bacteria 3608896
92 2809227443 2808606447 Bacteria 3572005
93 2812323118 2811994872 Bacteria 4121241
94 2821270013 2821268502 Bacteria 3750023
95 2833710961 2833709550 Bacteria 4008291
96 2852634201 2852632344 Bacteria 3463163
97 2852647380 2852646457 Bacteria 3408613
98 2852665362 2852663356 Bacteria 4090475
99 2857721613 2857720070 Bacteria 3189373
100 2857723986 2857723135 Bacteria 4217853
101 2857729975 2857729791 Bacteria 4040535
102 2870630358 2870628048 Bacteria 3696012
103 2906800722 2906799679 Bacteria 4031749
104 2919396570 2919395869 Bacteria 3704152
105 2928092260 2928090899 Bacteria 3158267
106 2928123197 2928121344 Bacteria 3972376
107 2935411554 2935409751 Bacteria 4179611
108 2939661215 2939660829 Bacteria 3784848
109 2945971862 2945968032 Bacteria 4111363
110 2946033698 2946033335 Bacteria 3835514
111 2946044320 2946041624 Bacteria 4191385
112 2946080833 2946080515 Bacteria 4310960
113 2977253889 2977251589 Bacteria 2952848
114 2984580964 2984580707 Bacteria 3351387
115 8004185067 8004182704 Bacteria 3391155
116 8004214330 8004212874 Bacteria 2861420
117 8045831595 8045830549 Bacteria 4444727
118 Ga0307406_10058677
119 JGI24740J21852_10019274
120 JGI25154J39366_1004807
121 Ga0075365_10007174
122 Ga0075368_10004765
123 Ga0075363_100085349
124 Ga0075364_10131990
125 Ga0075369_10047495
126 Ga0157371_10001820
127 Ga0157369_10087698
128 Ga0157375_10297847
129 Ga0209646_1000167
130 Ga0207647_10015346
131 Ga0207639_10280648
132 Ga0307405_10009047
133 Ga0307413_10160217
134 Ga0307410_10071860
135 Ga0307406_10000123
136 Ga0307406_10000602
137 Ga0307406_10102593
138 Ga0307407_10130179
139 Ga0307409_100016562
140 Ga0307409_100533763
141 Ga0307414_10091136
142 Ga0307415_100208749
143 Ga0307415_100265168
144 Ga0395898_0444589
145 Ga0451837_1799248
146 Ga0466965_0071208
147 Ga0466970_0000428
148 Ga0466970_0069510
149 Ga0495627_000742
150 Ga0495620_0048646
151 Ga0495645_0007535
152 Ga0496105_0220487
153 Ga0496114_0040447
154 Ga0496114_0154200
155 Ga0496115_0060424
156 Ga0496116_0112648
157 Ga0496118_0015248
158 Ga0496119_0002232
159 Ga0496119_0008633
160 Ga0496120_0002279
161 Ga0496122_0000030
162 Ga0496122_0017802
163 Ga0496122_0026081
164 Ga0496122_0062031
165 Ga0496123_0000024
166 Ga0496123_0030146
167 Ga0496124_0011174
168 Ga0496124_0071521
169 Ga0496124_0253841
170 Ga0496125_0000061
171 Ga0496125_0003349
172 Ga0496125_0015344
173 Ga0496125_0019154
174 Ga0496125_0072128
175 Ga0496125_0080008
176 Ga0496126_0004143
177 Ga0496126_0019540
178 Ga0496126_0121254
179 Ga0496126_0155188
180 Ga0501033_0109161
181 Ga0501034_0039896
182 Ga0501036_0131357
183 Ga0501038_0005618
184 Ga0501038_0085660
185 Ga0501039_0040308
186 Ga0501042_0003755
187 Ga0501046_0084810
188 Ga0501069_0230514
189 Ga0501070_0000716
190 Ga0501035_0051121
191 Ga0501044_0372395
192 nmdc:mga00v17_3671_c1
193 nmdc:mga00v17_45654_c1
194 nmdc:mga0yw44_2472_c1
195 nmdc:mga0sz30_54482_c1
196 2643733562
197 2643752283
198 2643785943
199 2643848289
200 2643885430
201 2643995727
202 2644170137
203 2644680356
204 2730229809
205 2747952028
206 2774384523
207 2774399533
208 2808631183
209 2809227443
210 2812323118
211 2821270013
212 2833710961
213 2852634201
214 2852647380
215 2852665362
216 2857721613
217 2857723986
218 2857729975
219 2870630358
220 2906800722
221 2919396570
222 2928092260
223 2928123197
224 2935411554
225 2939661215
226 2945971862
227 2946033698
228 2946044320
229 2946080833
230 2977253889
231 2984580964
232 8004185067
233 8004214330
234 8045831595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

18

314

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_4 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9737 1 302
2qc3-assembly1.cif.gz_A crystal structure of mcat from mycobacterium tuberculosis 0.9629 2 298
2qj3-assembly2.cif.gz_B mycobacterium tuberculosis fabd 0.9621 2 303
2cdh-assembly1.cif.gz_4 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.958 1 302
2qc3-assembly1.cif.gz_A crystal structure of mcat from mycobacterium tuberculosis 0.9443 2 298
ID Description Score Start End Superfamily
2qc3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9917 126 188 3.30.70.250
1nm2A02 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9842 1 297 3.40.366.10
1nm2A02 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9757 1 297 3.40.366.10
4rr5A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9621 2 296 3.40.366.10
2qc3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9613 126 188 3.30.70.250
ID Description Score Start End GO Terms
AF-A0A6J6X0D8-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9905 110 302 GO:0004314
GO:0005829
GO:0006633
AF-A0A7W9LIL8-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9876 27 300 GO:0004314
GO:0005829
GO:0006633
AF-A0A1Q5PZE0-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9742 1 303 GO:0004314
GO:0005829
GO:0006633
AF-A0A7X6EII9-F1-model_v4 deleted 0.974 1 190
AF-A0A7W9LIL8-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9733 27 300 GO:0004314
GO:0005829
GO:0006633

Map