F093244

General Info

Members Datasets Scaffolds Average Seq Length
117 56 234 262

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10156621|Ga0207712_101566213
Length 291
Sequence LSNIPIMEKPIITSLRNPLVKQARALHQKKARDESGLFLVEGIHHVGEVLEAAWDVEAILYAPDLLTSIFARDLISRHSSRFDYTSSAHIVPMPFRGPEPQPVSAQVMESLAGKENPQGIIAIVHQKQAQFSDLKSPGTGVALVSPQDPGNVGTVLRTLDAVGGDTLFILDSPLETRSSVELYHPTVIRSSMGTIFWKPLVRSSFEDFVQWARKGGYQLIGTSAHGDVGYQTLVPKTPWVLVLGNEQKGLSPEQMKACDVTVSMPMKGRVSSLNLAVAAGVLLYQFTVFSE

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
46 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
47 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
48 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
49 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
50 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
51 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
52 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
53 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
54 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
55 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
56 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10156621 3300025961 Bacteria 1765
2 JGI25406J46586_10006786 3300003203 Bacteria 5259
3 Ga0065704_10070694 3300005289 Bacteria 17563
4 Ga0065704_10086941 3300005289 Bacteria 3070
5 Ga0065707_10000504 3300005295 Bacteria 47061
6 Ga0065707_10089661 3300005295 Bacteria 4310
7 Ga0065707_10089725 3300005295 Unclassified 4295
8 Ga0065707_10120890 3300005295 Bacteria 2123
9 Ga0070689_100101725 3300005340 Bacteria 2275
10 Ga0070700_100059625 3300005441 Bacteria 2403
11 Ga0070694_100042486 3300005444 Bacteria 3037
12 Ga0070706_100219599 3300005467 Bacteria 1774
13 Ga0070707_100322842 3300005468 Bacteria 1500
14 Ga0070698_100029337 3300005471 Bacteria 5710
15 Ga0070698_100053072 3300005471 Bacteria 4121
16 Ga0070699_100001632 3300005518 Bacteria 20460
17 Ga0070699_100050431 3300005518 Unclassified 3603
18 Ga0070699_100464815 3300005518 Unclassified 1147
19 Ga0070696_100296451 3300005546 Bacteria 1237
20 Ga0070704_100081990 3300005549 Bacteria 2378
21 Ga0070704_100556415 3300005549 Bacteria 1003
22 Ga0068859_100025281 3300005617 Bacteria 5957
23 Ga0068862_100031900 3300005844 Unclassified 4450
24 Ga0081539_10033340 3300005985 Bacteria 3138
25 Ga0075427_10000375 3300006194 Unclassified 4960
26 Ga0075428_100057573 3300006844 Bacteria 4254
27 Ga0075428_100320613 3300006844 Bacteria 1665
28 Ga0075431_100032242 3300006847 Bacteria 5399
29 Ga0075431_100365827 3300006847 Bacteria 1448
30 Ga0075433_10034259 3300006852 Unclassified 4360
31 Ga0075433_10201236 3300006852 Bacteria 1770
32 Ga0075434_100044132 3300006871 Unclassified 4423
33 Ga0075429_100084671 3300006880 Bacteria 2763
34 Ga0097620_100025281 3300006931 Bacteria 5957
35 Ga0111539_10108742 3300009094 Bacteria 3254
36 Ga0111539_10683228 3300009094 Bacteria 1195
37 Ga0114129_10023658 3300009147 Bacteria 8708
38 Ga0114129_10054327 3300009147 Bacteria 5615
39 Ga0114129_10170418 3300009147 Unclassified 2968
40 Ga0114129_10183678 3300009147 Bacteria 2844
41 Ga0114129_10787210 3300009147 Bacteria 1214
42 Ga0105243_10025745 3300009148 Bacteria 4500
43 Ga0105249_10067304 3300009553 Bacteria 3300
44 Ga0105249_10273897 3300009553 Bacteria 1682
45 Ga0105246_10003950 3300011119 Bacteria 8989
46 Ga0207646_10063869 3300025922 Bacteria 3287
47 Ga0207646_10305439 3300025922 Bacteria 1437
48 Ga0207670_10073964 3300025936 Bacteria 2364
49 Ga0268265_10033057 3300028380 Bacteria 3757
50 Ga0268265_10223017 3300028380 Bacteria 1651
51 Ga0265334_10009262 3300028573 Unclassified 4166
52 Ga0265318_10002101 3300028577 Bacteria 10891
53 Ga0265331_10016138 3300031250 Unclassified 3927
54 Ga0265327_10005743 3300031251 Bacteria 10224
55 Ga0265316_10049195 3300031344 Unclassified 3322
56 Ga0316575_10006100 3300031665 Bacteria 4323
57 Ga0307407_10063764 3300031903 Bacteria 2163
58 Ga0373939_0049299 3300035114 Bacteria 1301
59 Ga0316574_0011559 3300035398 Bacteria 5021
60 Ga0451577_0002207 3300042876 Bacteria 23717
61 Ga0451577_0287962 3300042876 Bacteria 1489
62 Ga0451577_0422634 3300042876 Bacteria 1210
63 Ga0451577_0614262 3300042876 Bacteria 986
64 Ga0453683_0002551 3300044673 Bacteria 14041
65 Ga0453683_0022374 3300044673 Unclassified 4032
66 Ga0453683_0114780 3300044673 Unclassified 1694
67 Ga0453683_0172497 3300044673 Unclassified 1370
68 Ga0453683_0175026 3300044673 Bacteria 1360
69 Ga0453683_0196284 3300044673 Bacteria 1281
70 Ga0453684_0000535 3300044712 Bacteria 144635
71 Ga0453684_0000797 3300044712 Bacteria 107625
72 Ga0453684_0002544 3300044712 Bacteria 43868
73 Ga0453684_0003033 3300044712 Bacteria 39050
74 Ga0453684_0007959 3300044712 Bacteria 19216
75 Ga0453684_0014562 3300044712 Bacteria 12558
76 Ga0453684_0015656 3300044712 Bacteria 11957
77 Ga0453684_0047233 3300044712 Bacteria 5713
78 Ga0453684_0056617 3300044712 Bacteria 5084
79 Ga0453684_0059481 3300044712 Bacteria 4925
80 Ga0453684_0122402 3300044712 Unclassified 3139
81 Ga0453684_0192729 3300044712 Unclassified 2383
82 Ga0453684_0197448 3300044712 Bacteria 2348
83 Ga0453684_0305741 3300044712 Bacteria 1806
84 Ga0453684_0322840 3300044712 Bacteria 1748
85 Ga0453684_0368547 3300044712 Bacteria 1615
86 Ga0453684_0438225 3300044712 Bacteria 1456
87 Ga0453684_0456547 3300044712 Bacteria 1421
88 Ga0453684_0578772 3300044712 Unclassified 1233
89 Ga0453684_0619236 3300044712 Unclassified 1184
90 Ga0453684_0620662 3300044712 Bacteria 1183
91 Ga0453684_0744392 3300044712 Unclassified 1061
92 Ga0451576_0000009 3300045051 Bacteria 712666
93 Ga0451576_0013372 3300045051 Bacteria 9184
94 Ga0451576_0093402 3300045051 Unclassified 3128
95 Ga0451576_0166381 3300045051 Unclassified 2301
96 Ga0451576_0348882 3300045051 Bacteria 1550
97 Ga0451576_0671817 3300045051 Bacteria 1088
98 Ga0501071_0232786 3300049587 Unclassified 1388
99 Ga0501071_0506505 3300049587 Bacteria 926
100 Ga0501076_0056655 3300049592 Bacteria 3111
101 Ga0501076_0309200 3300049592 Bacteria 1296
102 Ga0501076_0606888 3300049592 Bacteria 903
103 Ga0501080_0042302 3300049742 Bacteria 4243
104 Ga0501081_0080418 3300049743 Bacteria 2281
105 Ga0501045_0118261 3300049824 Bacteria 1967
106 nmdc:mga05p37_162457_c1 3300050507 Bacteria 2727
107 nmdc:mga05p37_49127_c1 3300050507 Bacteria 5189
108 nmdc:mga05p37_83272_c1 3300050507 Unclassified 3941
109 nmdc:mga09592_172493_c1 3300050508 Bacteria 1374
110 nmdc:mga09592_186264_c1 3300050508 Unclassified 1796
111 nmdc:mga09592_35722_c1 3300050508 Bacteria 4161
112 nmdc:mga08y16_121154_c1 3300050511 Bacteria 2722
113 nmdc:mga0n895_119104_c1 3300050512 Unclassified 2661
114 nmdc:mga0a205_28191_c1 3300050515 Bacteria 5368
115 nmdc:mga0a205_732203_c1 3300050515 Bacteria 838
116 Ga0501084_0284574 3300054114 Bacteria 1396
117 Ga0501082_0229894 3300060353 Unclassified 1614
118 Ga0207712_10156621
119 JGI25406J46586_10006786
120 Ga0065704_10070694
121 Ga0065704_10086941
122 Ga0065707_10000504
123 Ga0065707_10089661
124 Ga0065707_10089725
125 Ga0065707_10120890
126 Ga0070689_100101725
127 Ga0070700_100059625
128 Ga0070694_100042486
129 Ga0070706_100219599
130 Ga0070707_100322842
131 Ga0070698_100029337
132 Ga0070698_100053072
133 Ga0070699_100001632
134 Ga0070699_100050431
135 Ga0070699_100464815
136 Ga0070696_100296451
137 Ga0070704_100081990
138 Ga0070704_100556415
139 Ga0068859_100025281
140 Ga0068862_100031900
141 Ga0081539_10033340
142 Ga0075427_10000375
143 Ga0075428_100057573
144 Ga0075428_100320613
145 Ga0075431_100032242
146 Ga0075431_100365827
147 Ga0075433_10034259
148 Ga0075433_10201236
149 Ga0075434_100044132
150 Ga0075429_100084671
151 Ga0097620_100025281
152 Ga0111539_10108742
153 Ga0111539_10683228
154 Ga0114129_10023658
155 Ga0114129_10054327
156 Ga0114129_10170418
157 Ga0114129_10183678
158 Ga0114129_10787210
159 Ga0105243_10025745
160 Ga0105249_10067304
161 Ga0105249_10273897
162 Ga0105246_10003950
163 Ga0207646_10063869
164 Ga0207646_10305439
165 Ga0207670_10073964
166 Ga0268265_10033057
167 Ga0268265_10223017
168 Ga0265334_10009262
169 Ga0265318_10002101
170 Ga0265331_10016138
171 Ga0265327_10005743
172 Ga0265316_10049195
173 Ga0316575_10006100
174 Ga0307407_10063764
175 Ga0373939_0049299
176 Ga0316574_0011559
177 Ga0451577_0002207
178 Ga0451577_0287962
179 Ga0451577_0422634
180 Ga0451577_0614262
181 Ga0453683_0002551
182 Ga0453683_0022374
183 Ga0453683_0114780
184 Ga0453683_0172497
185 Ga0453683_0175026
186 Ga0453683_0196284
187 Ga0453684_0000535
188 Ga0453684_0000797
189 Ga0453684_0002544
190 Ga0453684_0003033
191 Ga0453684_0007959
192 Ga0453684_0014562
193 Ga0453684_0015656
194 Ga0453684_0047233
195 Ga0453684_0056617
196 Ga0453684_0059481
197 Ga0453684_0122402
198 Ga0453684_0192729
199 Ga0453684_0197448
200 Ga0453684_0305741
201 Ga0453684_0322840
202 Ga0453684_0368547
203 Ga0453684_0438225
204 Ga0453684_0456547
205 Ga0453684_0578772
206 Ga0453684_0619236
207 Ga0453684_0620662
208 Ga0453684_0744392
209 Ga0451576_0000009
210 Ga0451576_0013372
211 Ga0451576_0093402
212 Ga0451576_0166381
213 Ga0451576_0348882
214 Ga0451576_0671817
215 Ga0501071_0232786
216 Ga0501071_0506505
217 Ga0501076_0056655
218 Ga0501076_0309200
219 Ga0501076_0606888
220 Ga0501080_0042302
221 Ga0501081_0080418
222 Ga0501045_0118261
223 nmdc:mga05p37_162457_c1
224 nmdc:mga05p37_49127_c1
225 nmdc:mga05p37_83272_c1
226 nmdc:mga09592_172493_c1
227 nmdc:mga09592_186264_c1
228 nmdc:mga09592_35722_c1
229 nmdc:mga08y16_121154_c1
230 nmdc:mga0n895_119104_c1
231 nmdc:mga0a205_28191_c1
232 nmdc:mga0a205_732203_c1
233 Ga0501084_0284574
234 Ga0501082_0229894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

138

284

0.91

PF22435

MRM3-like_sub_bind

MRM3-like substrate binding domain

17

122

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.9006 4 256
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8991 11 259
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8954 102 261
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.8905 1 256
1x7p-assembly1.cif.gz_A crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8889 11 259
ID Description Score Start End Superfamily
4x3lA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9142 112 259 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9074 104 260 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9046 108 258 3.40.1280.10
1x7pB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9027 114 259 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8926 101 260 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2D9WL72-F1-model_v4 rRNA methyltransferase 0.9464 5 259 GO:0003723
GO:0005737
GO:0006396
GO:0008173
GO:0032259
AF-A0A2U2SQK9-F1-model_v4 RNA methyltransferase 0.9412 1 260 GO:0003723
GO:0005737
GO:0006396
GO:0008173
GO:0032259
AF-A0A2D6CY61-F1-model_v4 rRNA methyltransferase 0.9358 4 260 GO:0003723
GO:0005737
GO:0006396
GO:0008173
GO:0032259
AF-A0A7X7G028-F1-model_v4 RNA methyltransferase 0.9343 1 260 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A2U2SQK9-F1-model_v4 RNA methyltransferase 0.9342 1 260 GO:0003723
GO:0005737
GO:0006396
GO:0008173
GO:0032259

Map