F089253

General Info

Members Datasets Scaffolds Average Seq Length
116 69 232 313

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0778131|Ga0436364_0778131_311_1402
Length 346
Sequence MCSRNGGVAGRNSLFTTATTRAAPIPAKSNGECFTATFDDGRRQRKELRRKDAFVRILITGGAGFIGSHVADAYCEAGHDVMILDALWEHGGGRRQNVPAAARFVQMDVRDDGIAEVFRDFRPEIVNHHAAQHSVAIGSRDPAYDAEVNVLGVLNLLKNAVAVGTQKVIFASSGATFGTPEHLPIDERTPQRPESPYGITKLASEYYLNVYGPRQDPNGEAGVIAIFIGKFLQRSSVRIDSDGEQTRDYVFVKDVADANVKALDHGNDAYCIGTNTRTSVNAIYRTLCEIAGVEPLVEHAPRRAGDARDAQFDPALARTQLQWQPATTLREGLQITYRYFSDLARQ

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
26 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 5.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 81.03
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0778131 3300037853 Bacteria 1424
2 Ga0070691_10006242 3300005341 Bacteria 5442
3 Ga0070714_100392614 3300005435 Bacteria 1310
4 Ga0070708_100001122 3300005445 Bacteria 20484
5 Ga0070663_100012159 3300005455 Bacteria 5435
6 Ga0070706_100005063 3300005467 Bacteria 12592
7 Ga0070707_100004078 3300005468 Bacteria 13713
8 Ga0070698_100007869 3300005471 Bacteria 11538
9 Ga0070699_100000968 3300005518 Bacteria 26755
10 Ga0070699_100011507 3300005518 Bacteria 7638
11 Ga0070697_100298623 3300005536 Bacteria 1384
12 Ga0070697_100387082 3300005536 Unclassified 1212
13 Ga0068854_100000008 3300005578 Bacteria 181750
14 Ga0068856_100017609 3300005614 Bacteria 6924
15 Ga0068852_100037627 3300005616 Bacteria 4059
16 Ga0070717_10004037 3300006028 Bacteria 10575
17 Ga0070717_10093793 3300006028 Unclassified 2538
18 Ga0105240_10050203 3300009093 Bacteria 5261
19 Ga0105240_10150361 3300009093 Bacteria 2774
20 Ga0105240_10376602 3300009093 Bacteria 1604
21 Ga0105242_10181857 3300009176 Bacteria 1855
22 Ga0206356_10488955 3300020070 Bacteria 5077
23 Ga0206349_1819058 3300020075 Unclassified 2352
24 Ga0206352_11144391 3300020078 Bacteria 9455
25 Ga0213873_10001895 3300021358 Bacteria 3550
26 Ga0213872_10009985 3300021361 Bacteria 4531
27 Ga0213872_10030860 3300021361 Bacteria 2456
28 Ga0213874_10000268 3300021377 Bacteria 10014
29 Ga0213874_10000542 3300021377 Bacteria 7568
30 Ga0213874_10012847 3300021377 Bacteria 2157
31 Ga0213876_10000630 3300021384 Bacteria 25669
32 Ga0213875_10000001 3300021388 Bacteria 2793540
33 Ga0213875_10070622 3300021388 Bacteria 1630
34 Ga0213875_10117008 3300021388 Bacteria 1245
35 Ga0213871_10000928 3300021441 Bacteria 4515
36 Ga0224712_10028679 3300022467 Bacteria 1992
37 Ga0207684_10004079 3300025910 Bacteria 13936
38 Ga0207684_10004994 3300025910 Bacteria 12359
39 Ga0207695_10035549 3300025913 Bacteria 5401
40 Ga0207695_10142711 3300025913 Bacteria 2341
41 Ga0207646_10001081 3300025922 Bacteria 34710
42 Ga0207646_10013232 3300025922 Bacteria 7893
43 Ga0207664_10025110 3300025929 Bacteria 4483
44 Ga0207686_10211008 3300025934 Bacteria 1396
45 Ga0207667_10000203 3300025949 Bacteria 86134
46 Ga0207640_10000008 3300025981 Bacteria 290578
47 Ga0207702_10348081 3300026078 Bacteria 1417
48 Ga0207698_10039592 3300026142 Bacteria 3494
49 Ga0265356_1000177 3300028017 Bacteria 11904
50 Ga0265338_10000367 3300028800 Bacteria 80983
51 Ga0265762_1005207 3300030760 Unclassified 2330
52 Ga0265760_10010143 3300031090 Bacteria 2687
53 Ga0265325_10002810 3300031241 Bacteria 11618
54 Ga0265325_10008644 3300031241 Bacteria 5997
55 Ga0265340_10036876 3300031247 Bacteria 2422
56 Ga0265339_10005700 3300031249 Bacteria 8263
57 Ga0265327_10107407 3300031251 Bacteria 1338
58 Ga0265316_10016901 3300031344 Bacteria 6317
59 Ga0265313_10001004 3300031595 Bacteria 27688
60 Ga0265342_10005746 3300031712 Bacteria 9377
61 Ga0316577_10029178 3300031733 Bacteria 3079
62 Ga0373933_0012211 3300035724 Bacteria 4745
63 Ga0373933_0081194 3300035724 Unclassified 1989
64 Ga0316582_0039278 3300036647 Bacteria 2946
65 Ga0316582_0211022 3300036647 Bacteria 1327
66 Ga0395898_0021038 3300037466 Bacteria 6618
67 Ga0436364_0273345 3300037853 Bacteria 2794207
68 Ga0436364_0537275 3300037853 Bacteria 29227
69 Ga0436364_1193184 3300037853 Bacteria 40961
70 Ga0436364_1381127 3300037853 Bacteria 7432
71 Ga0436364_1437724 3300037853 Bacteria 5263
72 Ga0395901_0021968 3300038443 Bacteria 6540
73 Ga0436365_0253133 3300039437 Bacteria 57018
74 Ga0436365_0472927 3300039437 Bacteria 1099
75 Ga0436365_1108192 3300039437 Bacteria 1396
76 Ga0436365_1695035 3300039437 Bacteria 137591
77 Ga0436360_0436720 3300039438 Bacteria 4210
78 Ga0436360_0485975 3300039438 Bacteria 38424
79 Ga0436360_0506786 3300039438 Bacteria 1155
80 Ga0436360_0590429 3300039438 Bacteria 3496
81 Ga0436360_0862739 3300039438 Bacteria 1240
82 Ga0436360_0936031 3300039438 Bacteria 1376
83 Ga0436361_0080514 3300039447 Bacteria 9149
84 Ga0436361_0198070 3300039447 Bacteria 76284
85 Ga0436361_0547394 3300039447 Bacteria 2239
86 Ga0436361_0564619 3300039447 Bacteria 7477
87 Ga0436361_0638121 3300039447 Bacteria 2144
88 Ga0436361_0675183 3300039447 Bacteria 1468
89 Ga0436361_0728460 3300039447 Bacteria 6734
90 Ga0436361_0854845 3300039447 Bacteria 2517
91 Ga0436361_1179410 3300039447 Bacteria 5951
92 Ga0436363_0360777 3300039450 Bacteria 7707
93 Ga0436363_0859014 3300039450 Bacteria 2334
94 Ga0436363_0936519 3300039450 Bacteria 2286
95 Ga0436363_1333927 3300039450 Bacteria 22487
96 Ga0436363_1680007 3300039450 Bacteria 61839
97 Ga0436362_0098598 3300039453 Bacteria 21624
98 Ga0436362_0098827 3300039453 Bacteria 20005
99 Ga0436362_0162290 3300039453 Bacteria 5261
100 Ga0436362_0215245 3300039453 Bacteria 2995
101 Ga0436362_1150845 3300039453 Bacteria 5406
102 Ga0436362_1220143 3300039453 Bacteria 1723
103 Ga0466969_0052809 3300044656 Unclassified 1996
104 Ga0466972_0054052 3300044658 Bacteria 1933
105 Ga0466966_0000421 3300044684 Bacteria 27208
106 Ga0466961_0012738 3300044693 Bacteria 5385
107 Ga0466964_0002891 3300044706 Bacteria 6203
108 Ga0466968_0000045 3300044735 Bacteria 35789
109 Ga0466970_0000058 3300044765 Bacteria 43095
110 Ga0466957_0031045 3300044842 Bacteria 3192
111 Ga0466957_0148025 3300044842 Bacteria 1517
112 Ga0466959_0001863 3300045049 Bacteria 13252
113 Ga0466958_0026311 3300045836 Bacteria 3438
114 Ga0466967_0030604 3300045976 Bacteria 4519
115 Ga0501039_0341656 3300049575 Bacteria 1176
116 Ga0501081_0128569 3300049743 Bacteria 1809
117 Ga0436364_0778131
118 Ga0070691_10006242
119 Ga0070714_100392614
120 Ga0070708_100001122
121 Ga0070663_100012159
122 Ga0070706_100005063
123 Ga0070707_100004078
124 Ga0070698_100007869
125 Ga0070699_100000968
126 Ga0070699_100011507
127 Ga0070697_100298623
128 Ga0070697_100387082
129 Ga0068854_100000008
130 Ga0068856_100017609
131 Ga0068852_100037627
132 Ga0070717_10004037
133 Ga0070717_10093793
134 Ga0105240_10050203
135 Ga0105240_10150361
136 Ga0105240_10376602
137 Ga0105242_10181857
138 Ga0206356_10488955
139 Ga0206349_1819058
140 Ga0206352_11144391
141 Ga0213873_10001895
142 Ga0213872_10009985
143 Ga0213872_10030860
144 Ga0213874_10000268
145 Ga0213874_10000542
146 Ga0213874_10012847
147 Ga0213876_10000630
148 Ga0213875_10000001
149 Ga0213875_10070622
150 Ga0213875_10117008
151 Ga0213871_10000928
152 Ga0224712_10028679
153 Ga0207684_10004079
154 Ga0207684_10004994
155 Ga0207695_10035549
156 Ga0207695_10142711
157 Ga0207646_10001081
158 Ga0207646_10013232
159 Ga0207664_10025110
160 Ga0207686_10211008
161 Ga0207667_10000203
162 Ga0207640_10000008
163 Ga0207702_10348081
164 Ga0207698_10039592
165 Ga0265356_1000177
166 Ga0265338_10000367
167 Ga0265762_1005207
168 Ga0265760_10010143
169 Ga0265325_10002810
170 Ga0265325_10008644
171 Ga0265340_10036876
172 Ga0265339_10005700
173 Ga0265327_10107407
174 Ga0265316_10016901
175 Ga0265313_10001004
176 Ga0265342_10005746
177 Ga0316577_10029178
178 Ga0373933_0012211
179 Ga0373933_0081194
180 Ga0316582_0039278
181 Ga0316582_0211022
182 Ga0395898_0021038
183 Ga0436364_0273345
184 Ga0436364_0537275
185 Ga0436364_1193184
186 Ga0436364_1381127
187 Ga0436364_1437724
188 Ga0395901_0021968
189 Ga0436365_0253133
190 Ga0436365_0472927
191 Ga0436365_1108192
192 Ga0436365_1695035
193 Ga0436360_0436720
194 Ga0436360_0485975
195 Ga0436360_0506786
196 Ga0436360_0590429
197 Ga0436360_0862739
198 Ga0436360_0936031
199 Ga0436361_0080514
200 Ga0436361_0198070
201 Ga0436361_0547394
202 Ga0436361_0564619
203 Ga0436361_0638121
204 Ga0436361_0675183
205 Ga0436361_0728460
206 Ga0436361_0854845
207 Ga0436361_1179410
208 Ga0436363_0360777
209 Ga0436363_0859014
210 Ga0436363_0936519
211 Ga0436363_1333927
212 Ga0436363_1680007
213 Ga0436362_0098598
214 Ga0436362_0098827
215 Ga0436362_0162290
216 Ga0436362_0215245
217 Ga0436362_1150845
218 Ga0436362_1220143
219 Ga0466969_0052809
220 Ga0466972_0054052
221 Ga0466966_0000421
222 Ga0466961_0012738
223 Ga0466964_0002891
224 Ga0466968_0000045
225 Ga0466970_0000058
226 Ga0466957_0031045
227 Ga0466957_0148025
228 Ga0466959_0001863
229 Ga0466958_0026311
230 Ga0466967_0030604
231 Ga0501039_0341656
232 Ga0501081_0128569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

55

215

0.94

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

209

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

206

273

0.89

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

58

336

0.89

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

57

232

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

58

210

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9748 1 307
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9686 1 307
2p5u-assembly1.cif.gz_D crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with nad 0.9541 1 307
6pnl-assembly1.cif.gz_A structure of epimerase mth375 from the thermophilic pseudomurein-containing methanogen methanothermobacter thermautotrophicus 0.9535 2 310
7ys9-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis 0.9512 1 306
ID Description Score Start End Superfamily
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.968 1 237 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 1 237 3.40.50.720
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9529 2 32 3.50.50.60
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9493 1 237 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 1 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C5QYH7-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9929 1 179 GO:0033499
AF-A0A7C5QYH7-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9874 1 179 GO:0033499
AF-A0A536HYN7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9843 44 307
AF-A0A1F8R7A1-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9838 73 303
AF-A0A2E0CK59-F1-model_v4 UDP-glucose 4-epimerase 0.9824 2 306

Map