F087528

General Info

Members Datasets Scaffolds Average Seq Length
116 86 232 137

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_101078944|Ga0068861_1010789442
Length 118
Sequence MIALRDLPAINATLNATAAVLLVWGYILVFLCCYLIYHFNVGSVRFPKTGAIRTVYLSILATHTALAAAVPPLAIITLNRGLRERYDRHRKIARWTLPVWLYVSVTGVVVYWMLYQMR

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
83 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
84 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
85 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
86 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 27.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_101078944 3300005719 Bacteria 771
2 Ga0065707_10611562 3300005295 Bacteria 680
3 Ga0070683_100000430 3300005329 Bacteria 29132
4 Ga0070683_100587634 3300005329 Unclassified 1065
5 Ga0070680_101023431 3300005336 Bacteria 713
6 Ga0070709_10498256 3300005434 Bacteria 925
7 Ga0070713_100112369 3300005436 Unclassified 2377
8 Ga0070713_100301488 3300005436 Unclassified 1475
9 Ga0070708_100206099 3300005445 Bacteria 1842
10 Ga0070708_100393590 3300005445 Bacteria 1307
11 Ga0070681_10036686 3300005458 Bacteria 4922
12 Ga0070706_100755502 3300005467 Bacteria 901
13 Ga0070707_100354186 3300005468 Bacteria 1426
14 Ga0070698_100023556 3300005471 Bacteria 6435
15 Ga0070699_100021790 3300005518 Bacteria 5523
16 Ga0070699_100027587 3300005518 Bacteria 4896
17 Ga0070699_100178225 3300005518 Bacteria 1885
18 Ga0070699_101399871 3300005518 Unclassified 641
19 Ga0070679_100168580 3300005530 Bacteria 2162
20 Ga0070684_100000418 3300005535 Bacteria 29139
21 Ga0070684_100254498 3300005535 Bacteria 1605
22 Ga0070697_100021047 3300005536 Bacteria 5165
23 Ga0068864_101443451 3300005618 Bacteria 690
24 Ga0068858_100706648 3300005842 Bacteria 981
25 Ga0070717_10117273 3300006028 Bacteria 2277
26 Ga0070716_100938793 3300006173 Unclassified 680
27 Ga0070716_101256482 3300006173 Bacteria 597
28 Ga0068871_100150857 3300006358 Bacteria 1982
29 Ga0068871_100532236 3300006358 Bacteria 1062
30 Ga0075428_101682013 3300006844 Unclassified 662
31 Ga0075430_100814651 3300006846 Unclassified 769
32 Ga0075431_100001035 3300006847 Bacteria 24776
33 Ga0075429_100087377 3300006880 Bacteria 2717
34 Ga0075429_101431761 3300006880 Bacteria 602
35 Ga0075436_100006868 3300006914 Bacteria 7784
36 Ga0075436_100047379 3300006914 Unclassified 2965
37 Ga0105240_10359415 3300009093 Bacteria 1650
38 Ga0105240_11237461 3300009093 Bacteria 789
39 Ga0111539_10592743 3300009094 Bacteria 1291
40 Ga0105245_10760384 3300009098 Bacteria 1005
41 Ga0105241_10108281 3300009174 Bacteria 2221
42 Ga0105242_10262365 3300009176 Bacteria 1561
43 Ga0105237_10157946 3300009545 Bacteria 2265
44 Ga0105237_10325063 3300009545 Bacteria 1542
45 Ga0105238_11220266 3300009551 Unclassified 777
46 Ga0105238_11659658 3300009551 Unclassified 670
47 Ga0105239_10341296 3300010375 Bacteria 1690
48 Ga0157370_10104957 3300013104 Bacteria 2645
49 Ga0157370_10309324 3300013104 Bacteria 1458
50 Ga0157370_10600483 3300013104 Bacteria 1008
51 Ga0157369_10115713 3300013105 Bacteria 2848
52 Ga0157369_11088793 3300013105 Bacteria 817
53 Ga0163162_12854938 3300013306 Unclassified 556
54 Ga0157372_10517586 3300013307 Bacteria 1391
55 Ga0157375_12106716 3300013308 Unclassified 671
56 Ga0163163_11875550 3300014325 Bacteria 659
57 Ga0207688_10834922 3300025901 Unclassified 584
58 Ga0207699_10485259 3300025906 Bacteria 890
59 Ga0207654_10208819 3300025911 Unclassified 1289
60 Ga0207707_10087651 3300025912 Bacteria 2719
61 Ga0207695_10049904 3300025913 Bacteria 4405
62 Ga0207660_10018672 3300025917 Bacteria 4627
63 Ga0207652_10071878 3300025921 Bacteria 3007
64 Ga0207652_10750209 3300025921 Bacteria 869
65 Ga0207646_10877569 3300025922 Bacteria 796
66 Ga0207700_11110667 3300025928 Bacteria 707
67 Ga0207700_11461677 3300025928 Unclassified 607
68 Ga0207686_10406208 3300025934 Bacteria 1039
69 Ga0207665_10528364 3300025939 Bacteria 914
70 Ga0207661_10001744 3300025944 Bacteria 14885
71 Ga0207675_100230462 3300026118 Bacteria 1787
72 Ga0209971_1067808 3300027682 Unclassified 865
73 Ga0209974_10116156 3300027876 Unclassified 945
74 Ga0265331_10320402 3300031250 Unclassified 694
75 Ga0265316_10008020 3300031344 Bacteria 9857
76 Ga0265316_10110179 3300031344 Unclassified 2085
77 Ga0265316_10243702 3300031344 Bacteria 1321
78 Ga0265316_10289406 3300031344 Unclassified 1195
79 Ga0265316_10488474 3300031344 Unclassified 880
80 Ga0373923_0075635 3300035111 Bacteria 1453
81 Ga0373954_0097451 3300035118 Unclassified 1417
82 Ga0373942_0157325 3300035207 Bacteria 733
83 Ga0373935_0035078 3300035692 Unclassified 3130
84 Ga0373935_1211406 3300035692 Bacteria 563
85 Ga0373927_0032977 3300035695 Bacteria 3372
86 Ga0373927_0486158 3300035695 Bacteria 816
87 Ga0373933_0495166 3300035724 Bacteria 801
88 Ga0373937_0037333 3300036401 Bacteria 4427
89 Ga0373937_0201493 3300036401 Unclassified 1871
90 Ga0373925_0051453 3300037068 Bacteria 3075
91 Ga0373925_0051739 3300037068 Bacteria 3067
92 Ga0436364_0643425 3300037853 Unclassified 1099
93 Ga0436362_0783991 3300039453 Bacteria 519
94 Ga0451802_0732042 3300041460 Bacteria 626
95 Ga0466963_0001890 3300044694 Bacteria 11437
96 Ga0466967_0407581 3300045976 Bacteria 1323
97 Ga0466967_1501329 3300045976 Unclassified 671
98 Ga0495580_0013050 3300046472 Bacteria 6359
99 Ga0495580_0338543 3300046472 Unclassified 1021
100 Ga0495630_1176942 3300046517 Bacteria 580
101 Ga0495640_0431987 3300046533 Bacteria 806
102 Ga0495674_0066980 3300047319 Unclassified 3113
103 Ga0496102_1250271 3300048905 Unclassified 662
104 Ga0501048_0199925 3300049582 Unclassified 1417
105 Ga0501075_0453774 3300049591 Bacteria 978
106 Ga0501045_0559474 3300049824 Bacteria 848
107 nmdc:mga09592_152318_c1 3300050508 Bacteria 1995
108 nmdc:mga0qj67_744437_c1 3300050509 Unclassified 778
109 nmdc:mga06r32_13259_c1 3300050510 Bacteria 7465
110 nmdc:mga08y16_463602_c1 3300050511 Bacteria 1291
111 nmdc:mga0rr50_1201631_c1 3300050513 Bacteria 644
112 nmdc:mga0rr50_591582_c1 3300050513 Bacteria 946
113 nmdc:mga08x19_683_c1 3300050514 Bacteria 21766
114 nmdc:mga0a205_463133_c1 3300050515 Bacteria 1127
115 Ga0495612_0416934 3300053078 Unclassified 611
116 Ga0501082_0001024 3300060353 Bacteria 24724
117 Ga0068861_101078944
118 Ga0065707_10611562
119 Ga0070683_100000430
120 Ga0070683_100587634
121 Ga0070680_101023431
122 Ga0070709_10498256
123 Ga0070713_100112369
124 Ga0070713_100301488
125 Ga0070708_100206099
126 Ga0070708_100393590
127 Ga0070681_10036686
128 Ga0070706_100755502
129 Ga0070707_100354186
130 Ga0070698_100023556
131 Ga0070699_100021790
132 Ga0070699_100027587
133 Ga0070699_100178225
134 Ga0070699_101399871
135 Ga0070679_100168580
136 Ga0070684_100000418
137 Ga0070684_100254498
138 Ga0070697_100021047
139 Ga0068864_101443451
140 Ga0068858_100706648
141 Ga0070717_10117273
142 Ga0070716_100938793
143 Ga0070716_101256482
144 Ga0068871_100150857
145 Ga0068871_100532236
146 Ga0075428_101682013
147 Ga0075430_100814651
148 Ga0075431_100001035
149 Ga0075429_100087377
150 Ga0075429_101431761
151 Ga0075436_100006868
152 Ga0075436_100047379
153 Ga0105240_10359415
154 Ga0105240_11237461
155 Ga0111539_10592743
156 Ga0105245_10760384
157 Ga0105241_10108281
158 Ga0105242_10262365
159 Ga0105237_10157946
160 Ga0105237_10325063
161 Ga0105238_11220266
162 Ga0105238_11659658
163 Ga0105239_10341296
164 Ga0157370_10104957
165 Ga0157370_10309324
166 Ga0157370_10600483
167 Ga0157369_10115713
168 Ga0157369_11088793
169 Ga0163162_12854938
170 Ga0157372_10517586
171 Ga0157375_12106716
172 Ga0163163_11875550
173 Ga0207688_10834922
174 Ga0207699_10485259
175 Ga0207654_10208819
176 Ga0207707_10087651
177 Ga0207695_10049904
178 Ga0207660_10018672
179 Ga0207652_10071878
180 Ga0207652_10750209
181 Ga0207646_10877569
182 Ga0207700_11110667
183 Ga0207700_11461677
184 Ga0207686_10406208
185 Ga0207665_10528364
186 Ga0207661_10001744
187 Ga0207675_100230462
188 Ga0209971_1067808
189 Ga0209974_10116156
190 Ga0265331_10320402
191 Ga0265316_10008020
192 Ga0265316_10110179
193 Ga0265316_10243702
194 Ga0265316_10289406
195 Ga0265316_10488474
196 Ga0373923_0075635
197 Ga0373954_0097451
198 Ga0373942_0157325
199 Ga0373935_0035078
200 Ga0373935_1211406
201 Ga0373927_0032977
202 Ga0373927_0486158
203 Ga0373933_0495166
204 Ga0373937_0037333
205 Ga0373937_0201493
206 Ga0373925_0051453
207 Ga0373925_0051739
208 Ga0436364_0643425
209 Ga0436362_0783991
210 Ga0451802_0732042
211 Ga0466963_0001890
212 Ga0466967_0407581
213 Ga0466967_1501329
214 Ga0495580_0013050
215 Ga0495580_0338543
216 Ga0495630_1176942
217 Ga0495640_0431987
218 Ga0495674_0066980
219 Ga0496102_1250271
220 Ga0501048_0199925
221 Ga0501075_0453774
222 Ga0501045_0559474
223 nmdc:mga09592_152318_c1
224 nmdc:mga0qj67_744437_c1
225 nmdc:mga06r32_13259_c1
226 nmdc:mga08y16_463602_c1
227 nmdc:mga0rr50_1201631_c1
228 nmdc:mga0rr50_591582_c1
229 nmdc:mga08x19_683_c1
230 nmdc:mga0a205_463133_c1
231 Ga0495612_0416934
232 Ga0501082_0001024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

26

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.8414 3 131
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.7688 7 135
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.758 5 138
8q1b-assembly1.cif.gz_c iii2-iv1 respiratory supercomplex from s. pombe 0.7544 1 138
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.752 5 137
ID Description Score Start End Superfamily
af_A0A5K1K958_64_247_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7562 1 135 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7536 1 139 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7443 1 137 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7414 1 138 1.20.120.80
af_I1LUR9_106_244_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.739 7 127 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A1F2R6T6-F1-model_v4 DUF420 domain-containing protein 0.9839 2 136 GO:0004129
GO:0016020
GO:0022904
AF-A0A2U3KTR5-F1-model_v4 Glycerophosphoryl diester phosphodiesterase (Modular protein) 0.9836 2 136 GO:0006629
GO:0008081
GO:0016020
AF-A0A7V8IXT8-F1-model_v4 Thioredoxin domain-containing protein 0.9812 2 136 GO:0016020
GO:0046872
AF-A0A356A6T4-F1-model_v4 deleted 0.9794 3 139
AF-A0A521X1G5-F1-model_v4 DUF420 domain-containing protein 0.9786 2 136 GO:0016020

Map