F084942

General Info

Members Datasets Scaffolds Average Seq Length
115 65 230 305

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0023505|Ga0451576_0023505_4705_5766
Length 353
Sequence LIFHEFLRTDLGLDFSHFTTNQVKNQPIFTGNGYRSLTVVRWYNDPMIKVVFMGSPDFSLPTLRVLAEAYEVVGVVTQPDRASGRGRELKPPPVKLLAQQLGIQVIQPEKLRQPEAMEQLRLWNPDVIIVAAFGQILKKDVLYLPRFGSLNVHASLLPRWRGAAPINAAILNGDNETGITIMKMDVGLDTGPILTQRSIPLTRQETAGSVSEKLSRLGADLLVETLPGYFSGKIQPAPQSEDGMTYAPMLKKEEGQLDFTQPADELERRVRAFNPWPGAFMDVDGTLLKIHRAHVAGGKAEAGQRLIYEDQPAVGAGGEIFILDEVQPAGKKSMSGKSFLAGARYWRQSDGKE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
54 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
55 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
56 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
57 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
61 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
62 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
63 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
64 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
65 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0023505 3300045051 Bacteria 6673
2 Ga0065704_10070672 3300005289 Bacteria 17902
3 Ga0065707_10002511 3300005295 Bacteria 4505
4 Ga0065707_10003665 3300005295 Bacteria 5914
5 Ga0070680_100123782 3300005336 Bacteria 2160
6 Ga0070700_100021703 3300005441 Bacteria 3735
7 Ga0070694_100023158 3300005444 Bacteria 3990
8 Ga0070663_100407184 3300005455 Bacteria 1113
9 Ga0070698_100005709 3300005471 Bacteria 13621
10 Ga0070698_100412002 3300005471 Bacteria 1285
11 Ga0070699_100002435 3300005518 Bacteria 16699
12 Ga0070699_100102867 3300005518 Unclassified 2505
13 Ga0070699_100107182 3300005518 Bacteria 2451
14 Ga0070695_100007239 3300005545 Bacteria 6577
15 Ga0068859_100256635 3300005617 Bacteria 1839
16 Ga0068859_100258233 3300005617 Bacteria 1833
17 Ga0068864_100087061 3300005618 Bacteria 2749
18 Ga0068858_100158987 3300005842 Bacteria 2127
19 Ga0068862_100009925 3300005844 Bacteria 7864
20 Ga0068862_100093605 3300005844 Unclassified 2620
21 Ga0070712_100014947 3300006175 Bacteria 4990
22 Ga0075428_100059329 3300006844 Bacteria 4190
23 Ga0075428_100116007 3300006844 Unclassified 2917
24 Ga0075428_100326719 3300006844 Bacteria 1648
25 Ga0075430_100027676 3300006846 Bacteria 4816
26 Ga0075430_100226363 3300006846 Bacteria 1551
27 Ga0075431_100002525 3300006847 Bacteria 17652
28 Ga0075431_100196200 3300006847 Bacteria 2067
29 Ga0075431_100200770 3300006847 Bacteria 2040
30 Ga0075429_100036343 3300006880 Bacteria 4284
31 Ga0097620_100256654 3300006931 Bacteria 1839
32 Ga0097620_100258239 3300006931 Bacteria 1833
33 Ga0111539_10010841 3300009094 Bacteria 11473
34 Ga0114129_10003975 3300009147 Bacteria 20882
35 Ga0114129_10007221 3300009147 Bacteria 15817
36 Ga0114129_10010605 3300009147 Bacteria 13139
37 Ga0114129_10026046 3300009147 Bacteria 8281
38 Ga0114129_10091498 3300009147 Bacteria 4214
39 Ga0114129_10128010 3300009147 Unclassified 3490
40 Ga0105249_10185305 3300009553 Unclassified 2028
41 Ga0105246_10336831 3300011119 Bacteria 1231
42 Ga0207707_10059282 3300025912 Bacteria 3331
43 Ga0207707_10200261 3300025912 Bacteria 1741
44 Ga0207660_10157318 3300025917 Bacteria 1750
45 Ga0207652_10419054 3300025921 Bacteria 1208
46 Ga0207646_10079106 3300025922 Bacteria 2939
47 Ga0207646_10296819 3300025922 Bacteria 1460
48 Ga0207670_10351967 3300025936 Unclassified 1166
49 Ga0207712_10065354 3300025961 Unclassified 2596
50 Ga0207428_10345653 3300027907 Bacteria 1095
51 Ga0268265_10193152 3300028380 Bacteria 1760
52 Ga0265318_10007714 3300028577 Bacteria 4844
53 Ga0265323_10069399 3300028653 Bacteria 1208
54 Ga0265338_10052565 3300028800 Bacteria 3653
55 Ga0265320_10028422 3300031240 Bacteria 2904
56 Ga0265340_10007044 3300031247 Bacteria 6132
57 Ga0307408_100084605 3300031548 Bacteria 2380
58 Ga0316578_10024026 3300031728 Bacteria 3417
59 Ga0316578_10069011 3300031728 Unclassified 2091
60 Ga0307405_10323370 3300031731 Bacteria 1179
61 Ga0316577_10014617 3300031733 Bacteria 4310
62 Ga0316577_10035954 3300031733 Bacteria 2769
63 Ga0307413_10008644 3300031824 Bacteria 4823
64 Ga0307416_100117393 3300032002 Bacteria 2362
65 Ga0307411_10124808 3300032005 Bacteria 1870
66 Ga0373927_0001094 3300035695 Bacteria 20614
67 Ga0316582_0002722 3300036647 Bacteria 8395
68 Ga0316582_0040710 3300036647 Bacteria 2901
69 Ga0316582_0054525 3300036647 Bacteria 2545
70 Ga0316584_0001193 3300036712 Bacteria 15388
71 Ga0451577_0008112 3300042876 Bacteria 10250
72 Ga0451577_0029074 3300042876 Bacteria 4997
73 Ga0451577_0045653 3300042876 Bacteria 3921
74 Ga0451577_0107498 3300042876 Unclassified 2493
75 Ga0453683_0001400 3300044673 Bacteria 20958
76 Ga0453683_0021606 3300044673 Bacteria 4108
77 Ga0453683_0138542 3300044673 Unclassified 1535
78 Ga0466963_0103372 3300044694 Bacteria 1952
79 Ga0453684_0000840 3300044712 Bacteria 103623
80 Ga0453684_0007754 3300044712 Bacteria 19578
81 Ga0453684_0012447 3300044712 Bacteria 14024
82 Ga0453684_0013108 3300044712 Bacteria 13532
83 Ga0453684_0033578 3300044712 Bacteria 7149
84 Ga0453684_0064275 3300044712 Bacteria 4688
85 Ga0453684_0086824 3300044712 Bacteria 3880
86 Ga0453684_0233597 3300044712 Bacteria 2121
87 Ga0453684_0316305 3300044712 Bacteria 1769
88 Ga0453684_0331440 3300044712 Bacteria 1721
89 Ga0453684_0437539 3300044712 Bacteria 1458
90 Ga0453684_0437927 3300044712 Bacteria 1457
91 Ga0466959_0035806 3300045049 Unclassified 3668
92 Ga0451576_0013042 3300045051 Bacteria 9309
93 Ga0451576_0020443 3300045051 Bacteria 7210
94 Ga0451576_0045474 3300045051 Bacteria 4623
95 Ga0451576_0209005 3300045051 Bacteria 2038
96 Ga0495580_0012502 3300046472 Bacteria 6508
97 Ga0501071_0182623 3300049587 Bacteria 1572
98 Ga0501073_0072200 3300049589 Bacteria 2404
99 Ga0501075_0059011 3300049591 Bacteria 2890
100 Ga0501076_0038912 3300049592 Bacteria 3733
101 Ga0501079_0375481 3300049741 Bacteria 1115
102 Ga0501080_0089510 3300049742 Bacteria 2859
103 Ga0501080_0114992 3300049742 Unclassified 2495
104 nmdc:mga05p37_121730_c1 3300050507 Bacteria 3205
105 nmdc:mga05p37_23153_c1 3300050507 Bacteria 7537
106 nmdc:mga05p37_29877_c1 3300050507 Bacteria 6650
107 nmdc:mga05p37_373091_c1 3300050507 Bacteria 1674
108 nmdc:mga05p37_45106_c1 3300050507 Bacteria 5423
109 nmdc:mga09592_30354_c1 3300050508 Bacteria 1913
110 nmdc:mga09592_85278_c1 3300050508 Bacteria 2694
111 nmdc:mga06r32_211082_c1 3300050510 Bacteria 1929
112 nmdc:mga06r32_4397_c1 3300050510 Bacteria 12606
113 nmdc:mga0n895_492103_c1 3300050512 Bacteria 1236
114 nmdc:mga0a205_33532_c1 3300050515 Unclassified 4923
115 Ga0501084_0223693 3300054114 Bacteria 1588
116 Ga0451576_0023505
117 Ga0065704_10070672
118 Ga0065707_10002511
119 Ga0065707_10003665
120 Ga0070680_100123782
121 Ga0070700_100021703
122 Ga0070694_100023158
123 Ga0070663_100407184
124 Ga0070698_100005709
125 Ga0070698_100412002
126 Ga0070699_100002435
127 Ga0070699_100102867
128 Ga0070699_100107182
129 Ga0070695_100007239
130 Ga0068859_100256635
131 Ga0068859_100258233
132 Ga0068864_100087061
133 Ga0068858_100158987
134 Ga0068862_100009925
135 Ga0068862_100093605
136 Ga0070712_100014947
137 Ga0075428_100059329
138 Ga0075428_100116007
139 Ga0075428_100326719
140 Ga0075430_100027676
141 Ga0075430_100226363
142 Ga0075431_100002525
143 Ga0075431_100196200
144 Ga0075431_100200770
145 Ga0075429_100036343
146 Ga0097620_100256654
147 Ga0097620_100258239
148 Ga0111539_10010841
149 Ga0114129_10003975
150 Ga0114129_10007221
151 Ga0114129_10010605
152 Ga0114129_10026046
153 Ga0114129_10091498
154 Ga0114129_10128010
155 Ga0105249_10185305
156 Ga0105246_10336831
157 Ga0207707_10059282
158 Ga0207707_10200261
159 Ga0207660_10157318
160 Ga0207652_10419054
161 Ga0207646_10079106
162 Ga0207646_10296819
163 Ga0207670_10351967
164 Ga0207712_10065354
165 Ga0207428_10345653
166 Ga0268265_10193152
167 Ga0265318_10007714
168 Ga0265323_10069399
169 Ga0265338_10052565
170 Ga0265320_10028422
171 Ga0265340_10007044
172 Ga0307408_100084605
173 Ga0316578_10024026
174 Ga0316578_10069011
175 Ga0307405_10323370
176 Ga0316577_10014617
177 Ga0316577_10035954
178 Ga0307413_10008644
179 Ga0307416_100117393
180 Ga0307411_10124808
181 Ga0373927_0001094
182 Ga0316582_0002722
183 Ga0316582_0040710
184 Ga0316582_0054525
185 Ga0316584_0001193
186 Ga0451577_0008112
187 Ga0451577_0029074
188 Ga0451577_0045653
189 Ga0451577_0107498
190 Ga0453683_0001400
191 Ga0453683_0021606
192 Ga0453683_0138542
193 Ga0466963_0103372
194 Ga0453684_0000840
195 Ga0453684_0007754
196 Ga0453684_0012447
197 Ga0453684_0013108
198 Ga0453684_0033578
199 Ga0453684_0064275
200 Ga0453684_0086824
201 Ga0453684_0233597
202 Ga0453684_0316305
203 Ga0453684_0331440
204 Ga0453684_0437539
205 Ga0453684_0437927
206 Ga0466959_0035806
207 Ga0451576_0013042
208 Ga0451576_0020443
209 Ga0451576_0045474
210 Ga0451576_0209005
211 Ga0495580_0012502
212 Ga0501071_0182623
213 Ga0501073_0072200
214 Ga0501075_0059011
215 Ga0501076_0038912
216 Ga0501079_0375481
217 Ga0501080_0089510
218 Ga0501080_0114992
219 nmdc:mga05p37_121730_c1
220 nmdc:mga05p37_23153_c1
221 nmdc:mga05p37_29877_c1
222 nmdc:mga05p37_373091_c1
223 nmdc:mga05p37_45106_c1
224 nmdc:mga09592_30354_c1
225 nmdc:mga09592_85278_c1
226 nmdc:mga06r32_211082_c1
227 nmdc:mga06r32_4397_c1
228 nmdc:mga0n895_492103_c1
229 nmdc:mga0a205_33532_c1
230 Ga0501084_0223693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

49

226

0.94

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

249

344

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.964 1 300
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9578 1 300
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9569 3 300
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9488 1 298
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9446 3 300
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.961 1 205 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9561 1 205 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9547 2 298 3.40.50.12230
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9522 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9455 3 205 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A432IEX0-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.976 2 246 GO:0004479
GO:0005829
AF-A0A3D0WA23-F1-model_v4 Methionyl-tRNA formyltransferase 0.9757 109 296 GO:0004479
GO:0005829
AF-A0A1G2B0Y0-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9738 2 298 GO:0004479
GO:0005829
AF-A0A3M0WRV9-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9737 1 227 GO:0004479
GO:0005829
AF-A0A7C5PBG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9733 44 298 GO:0004479
GO:0005829

Map