F084151

General Info

Members Datasets Scaffolds Average Seq Length
115 86 115 224

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10034237|Ga0265336_100342372
Length 252
Sequence MHHLANARVGLNNLIKKTTMNFAEQILAFNQSLVIDESLLPEGIAVMNPFRDERVLQITQTFYRKYFDDNQKRFMIIGINPGRFGGGVTGIPFTDPHKLNNYCGIKIGDLSAPELSADFVYNVINQYGGTEKFYKKFFLTAVSPLGFLKSKNGKMINYNYYDSNELQEAIRDFIIDSITRQLAFGIHRSVCFCLGTGKNYEYLSKLNASHGFFKEIVPLSHPRFVMQYRRKKIDQFVDEYLAAFKMAEAKIL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
72 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
73 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
74 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
78 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
79 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
80 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
81 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
82 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
83 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
84 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
85 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
86 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.17
Nodule 0
Rhizoplane 0.87
Rhizosphere 71.3
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001324 3300003316 Bacteria 8014
2 rootH2_10003834 3300003320 Bacteria 38010
3 rootH2_10027706 3300003320 Bacteria 2504
4 rootL2_10000507 3300003322 Bacteria 11641
5 rootL2_10008987 3300003322 Bacteria 11457
6 rootL2_10123716 3300003322 Bacteria 3783
7 rootL2_10142361 3300003322 Bacteria 1289
8 rootH1_10013570 3300003323 Bacteria 15862
9 rootH1_10083436 3300003323 Bacteria 2058
10 rootH1_10212796 3300003323 Bacteria 5777
11 Ga0065165_1001051 3300005262 Bacteria 33237
12 Ga0070676_10368171 3300005328 Unclassified 992
13 Ga0070683_100007365 3300005329 Bacteria 9297
14 Ga0070666_10000132 3300005335 Bacteria 52718
15 Ga0068868_100109346 3300005338 Unclassified 2245
16 Ga0070691_10018495 3300005341 Unclassified 3213
17 Ga0070691_10099150 3300005341 Bacteria 1445
18 Ga0070671_100093257 3300005355 Bacteria 2524
19 Ga0070674_100500004 3300005356 Bacteria 1012
20 Ga0070673_100088594 3300005364 Bacteria 2524
21 Ga0070688_100281396 3300005365 Bacteria 1195
22 Ga0068867_100051069 3300005459 Bacteria 3049
23 Ga0068867_100319945 3300005459 Bacteria 1285
24 Ga0068867_100600444 3300005459 Bacteria 960
25 Ga0070707_100373829 3300005468 Bacteria 1385
26 Ga0070684_100007719 3300005535 Bacteria 8386
27 Ga0068855_100000454 3300005563 Bacteria 50341
28 Ga0068854_100129212 3300005578 Unclassified 1927
29 Ga0068852_100280236 3300005616 Unclassified 1607
30 Ga0068859_100433901 3300005617 Bacteria 1410
31 Ga0068866_10236149 3300005718 Bacteria 1111
32 Ga0068860_100052497 3300005843 Bacteria 3878
33 Ga0097621_100032155 3300006237 Bacteria 4169
34 Ga0097621_100348253 3300006237 Unclassified 1317
35 Ga0068871_100491512 3300006358 Bacteria 1105
36 Ga0075431_101123587 3300006847 Bacteria 750
37 Ga0068865_100442334 3300006881 Bacteria 1073
38 Ga0068865_100925482 3300006881 Bacteria 759
39 Ga0097620_100433898 3300006931 Bacteria 1410
40 Ga0105240_10005924 3300009093 Bacteria 18106
41 Ga0105240_10842555 3300009093 Bacteria 990
42 Ga0111539_10038656 3300009094 Bacteria 5758
43 Ga0105245_10222584 3300009098 Bacteria 1822
44 Ga0105241_10035268 3300009174 Bacteria 3762
45 Ga0105241_10518189 3300009174 Unclassified 1066
46 Ga0105242_10129643 3300009176 Bacteria 2175
47 Ga0105242_10369221 3300009176 Bacteria 1330
48 Ga0105239_10005357 3300010375 Bacteria 15059
49 Ga0105239_10079290 3300010375 Bacteria 3614
50 Ga0105239_10637033 3300010375 Bacteria 1217
51 Ga0157371_10047012 3300013102 Bacteria 3067
52 Ga0157369_10121428 3300013105 Unclassified 2772
53 Ga0157374_10662822 3300013296 Bacteria 1055
54 Ga0157378_10771966 3300013297 Unclassified 985
55 Ga0163162_10003888 3300013306 Bacteria 14336
56 Ga0163162_10211178 3300013306 Bacteria 2071
57 Ga0157372_10008075 3300013307 Bacteria 11195
58 Ga0157372_10025440 3300013307 Bacteria 6436
59 Ga0157372_10669441 3300013307 Bacteria 1208
60 Ga0157380_10012287 3300014326 Bacteria 6207
61 Ga0157380_10125808 3300014326 Bacteria 2178
62 Ga0163161_10210705 3300017792 Bacteria 1501
63 Ga0209050_1003237 3300025298 Bacteria 12267
64 Ga0209050_1020527 3300025298 Bacteria 2455
65 Ga0207647_10060433 3300025904 Bacteria 2316
66 Ga0207695_10000073 3300025913 Bacteria 312565
67 Ga0207695_10630400 3300025913 Bacteria 953
68 Ga0207671_10682840 3300025914 Bacteria 817
69 Ga0207661_10003174 3300025944 Bacteria 11401
70 Ga0207667_10000745 3300025949 Bacteria 42269
71 Ga0207651_10131865 3300025960 Bacteria 1914
72 Ga0207648_10014157 3300026089 Bacteria 7377
73 Ga0207648_10102101 3300026089 Bacteria 2513
74 Ga0207648_10887212 3300026089 Bacteria 833
75 Ga0207676_10601884 3300026095 Bacteria 1056
76 Ga0207698_10262291 3300026142 Bacteria 1588
77 Ga0265336_10034237 3300028666 Bacteria 1571
78 Ga0307515_10000003 3300028794 Bacteria 891317
79 Ga0307515_10000031 3300028794 Bacteria 358648
80 Ga0307515_10083754 3300028794 Bacteria 4107
81 Ga0307515_10207006 3300028794 Bacteria 1818
82 Ga0307513_10064498 3300031456 Unclassified 3860
83 Ga0307513_10119219 3300031456 Bacteria 2611
84 Ga0307509_10080599 3300031507 Unclassified 3366
85 Ga0307408_100024939 3300031548 Bacteria 4090
86 Ga0307514_10164506 3300031649 Bacteria 1462
87 Ga0307405_10140927 3300031731 Bacteria 1681
88 Ga0307413_10790189 3300031824 Unclassified 797
89 Ga0307407_10114336 3300031903 Bacteria 1700
90 Ga0307409_100001277 3300031995 Bacteria 12169
91 Ga0307416_100000638 3300032002 Bacteria 18094
92 Ga0307415_100001717 3300032126 Bacteria 10655
93 Ga0451807_2372668 3300041486 Unclassified 716
94 Ga0451577_0020593 3300042876 Bacteria 6049
95 Ga0453684_0000626 3300044712 Bacteria 128697
96 Ga0495638_0000005 3300046460 Bacteria 680627
97 Ga0501300_010712 3300049523 Bacteria 1336
98 Ga0501047_0177121 3300049581 Unclassified 2000
99 Ga0501202_002974 3300049652 Bacteria 2876
100 Ga0501247_003796 3300049677 Unclassified 1634
101 Ga0501264_000224 3300049761 Bacteria 9262
102 Ga0501271_005795 3300049768 Bacteria 1213
103 nmdc:mga0qj67_455420_c1 3300050509 Bacteria 1030
104 nmdc:mga08y16_64892_c1 3300050511 Bacteria 3812
105 Ga0500644_0043237 3300053088 Unclassified 1506
106 Ga0500583_0209446 3300053092 Bacteria 968
107 Ga0500557_070375 3300053105 Bacteria 1147
108 Ga0500562_036993 3300053108 Unclassified 1295
109 Ga0500597_184539 3300053120 Bacteria 883
110 Ga0500568_0113664 3300053139 Bacteria 1011
111 Ga0500588_0000628 3300053146 Bacteria 5853
112 Ga0500604_0027838 3300053151 Bacteria 1638
113 Ga0500616_0000003 3300053153 Bacteria 1220687
114 Ga0500622_0000041 3300053156 Bacteria 170067
115 Ga0500622_0000045 3300053156 Bacteria 158316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0043237 Ga0500644_0043237_52_615 186
2 3300041486 Ga0451807_2372668 Ga0451807_2372668_114_701 194
3 3300028794 Ga0307515_10207006 Ga0307515_102070062 196
4 3300003322 rootL2_10000507 rootL2_100005074 197
5 3300005328 Ga0070676_10368171 Ga0070676_103681711 208
6 3300005459 Ga0068867_100051069 Ga0068867_1000510692 208
7 3300005617 Ga0068859_100433901 Ga0068859_1004339012 208
8 3300005718 Ga0068866_10236149 Ga0068866_102361492 208
9 3300005843 Ga0068860_100052497 Ga0068860_1000524972 208
10 3300006237 Ga0097621_100348253 Ga0097621_1003482532 208
11 3300006358 Ga0068871_100491512 Ga0068871_1004915121 208
12 3300006931 Ga0097620_100433898 Ga0097620_1004338982 208
13 3300026089 Ga0207648_10014157 Ga0207648_100141572 208
14 3300005356 Ga0070674_100500004 Ga0070674_1005000041 212
15 3300031731 Ga0307405_10140927 Ga0307405_101409272 212
16 3300031903 Ga0307407_10114336 Ga0307407_101143362 212
17 3300031995 Ga0307409_100001277 Ga0307409_10000127711 212
18 3300032002 Ga0307416_100000638 Ga0307416_1000006388 212
19 3300032126 Ga0307415_100001717 Ga0307415_1000017178 212
20 3300053108 Ga0500562_036993 Ga0500562_036993_460_1122 219
21 3300053151 Ga0500604_0027838 Ga0500604_0027838_136_798 219
22 3300053156 Ga0500622_0000041 Ga0500622_0000041_87721_88383 219
23 3300053156 Ga0500622_0000045 Ga0500622_0000045_61184_61846 219
24 3300005262 Ga0065165_1001051 Ga0065165_100105119 221
25 3300006847 Ga0075431_101123587 Ga0075431_1011235871 221
26 3300006881 Ga0068865_100925482 Ga0068865_1009254821 221
27 3300009094 Ga0111539_10038656 Ga0111539_100386563 221
28 3300009176 Ga0105242_10129643 Ga0105242_101296432 221
29 3300013102 Ga0157371_10047012 Ga0157371_100470122 221
30 3300013307 Ga0157372_10025440 Ga0157372_100254403 221
31 3300014326 Ga0157380_10012287 Ga0157380_100122872 221
32 3300025298 Ga0209050_1003237 Ga0209050_10032377 221
33 3300025298 Ga0209050_1020527 Ga0209050_10205272 221
34 3300028794 Ga0307515_10000003 Ga0307515_1000000361 221
35 3300028794 Ga0307515_10083754 Ga0307515_100837543 221
36 3300031548 Ga0307408_100024939 Ga0307408_1000249392 221
37 3300031649 Ga0307514_10164506 Ga0307514_101645062 221
38 3300046460 Ga0495638_0000005 Ga0495638_0000005_256306_256974 221
39 3300050509 nmdc:mga0qj67_455420_c1 nmdc:mga0qj67_455420_c1_330_1001 221
40 3300050511 nmdc:mga08y16_64892_c1 nmdc:mga08y16_64892_c1_516_1187 221
41 3300053105 Ga0500557_070375 Ga0500557_070375_427_1095 221
42 3300053153 Ga0500616_0000003 Ga0500616_0000003_793012_793680 221
43 3300005335 Ga0070666_10000132 Ga0070666_100001323 222
44 3300005338 Ga0068868_100109346 Ga0068868_1001093462 222
45 3300005355 Ga0070671_100093257 Ga0070671_1000932572 222
46 3300005364 Ga0070673_100088594 Ga0070673_1000885944 222
47 3300005365 Ga0070688_100281396 Ga0070688_1002813962 222
48 3300005468 Ga0070707_100373829 Ga0070707_1003738292 222
49 3300006237 Ga0097621_100032155 Ga0097621_1000321553 222
50 3300009093 Ga0105240_10842555 Ga0105240_108425551 222
51 3300009098 Ga0105245_10222584 Ga0105245_102225842 222
52 3300009174 Ga0105241_10035268 Ga0105241_100352683 222
53 3300009174 Ga0105241_10518189 Ga0105241_105181891 222
54 3300010375 Ga0105239_10079290 Ga0105239_100792902 222
55 3300013306 Ga0163162_10003888 Ga0163162_100038882 222
56 3300013307 Ga0157372_10669441 Ga0157372_106694412 222
57 3300025904 Ga0207647_10060433 Ga0207647_100604332 222
58 3300025913 Ga0207695_10630400 Ga0207695_106304002 222
59 3300025914 Ga0207671_10682840 Ga0207671_106828402 222
60 3300025960 Ga0207651_10131865 Ga0207651_101318652 222
61 3300028794 Ga0307515_10000031 Ga0307515_10000031161 222
62 3300031456 Ga0307513_10064498 Ga0307513_100644982 222
63 3300031456 Ga0307513_10119219 Ga0307513_101192192 222
64 3300031507 Ga0307509_10080599 Ga0307509_100805992 222
65 3300031824 Ga0307413_10790189 Ga0307413_107901891 222
66 3300049523 Ga0501300_010712 Ga0501300_010712_535_1206 222
67 3300049677 Ga0501247_003796 Ga0501247_003796_545_1216 222
68 3300049768 Ga0501271_005795 Ga0501271_005795_373_1044 222
69 3300053092 Ga0500583_0209446 Ga0500583_0209446_200_871 222
70 3300053120 Ga0500597_184539 Ga0500597_184539_47_724 222
71 3300053146 Ga0500588_0000628 Ga0500588_0000628_3767_4456 222
72 3300003320 rootH2_10027706 rootH2_100277063 223
73 3300003322 rootL2_10142361 rootL2_101423612 223
74 3300005459 Ga0068867_100319945 Ga0068867_1003199451 223
75 3300005459 Ga0068867_100600444 Ga0068867_1006004441 223
76 3300010375 Ga0105239_10637033 Ga0105239_106370331 223
77 3300013306 Ga0163162_10211178 Ga0163162_102111781 223
78 3300014326 Ga0157380_10125808 Ga0157380_101258081 223
79 3300017792 Ga0163161_10210705 Ga0163161_102107052 223
80 3300026089 Ga0207648_10102101 Ga0207648_101021012 223
81 3300026089 Ga0207648_10887212 Ga0207648_108872121 223
82 3300026095 Ga0207676_10601884 Ga0207676_106018842 223
83 3300049581 Ga0501047_0177121 Ga0501047_0177121_571_1281 223
84 3300003322 rootL2_10123716 rootL2_101237162 224
85 3300006881 Ga0068865_100442334 Ga0068865_1004423342 224
86 3300003323 rootH1_10212796 rootH1_102127962 225
87 3300005329 Ga0070683_100007365 Ga0070683_1000073652 225
88 3300005341 Ga0070691_10099150 Ga0070691_100991503 225
89 3300005535 Ga0070684_100007719 Ga0070684_1000077196 225
90 3300005563 Ga0068855_100000454 Ga0068855_10000045428 225
91 3300005578 Ga0068854_100129212 Ga0068854_1001292123 225
92 3300005616 Ga0068852_100280236 Ga0068852_1002802363 225
93 3300009093 Ga0105240_10005924 Ga0105240_100059249 225
94 3300010375 Ga0105239_10005357 Ga0105239_1000535716 225
95 3300013105 Ga0157369_10121428 Ga0157369_101214283 225
96 3300013307 Ga0157372_10008075 Ga0157372_100080752 225
97 3300025913 Ga0207695_10000073 Ga0207695_10000073236 225
98 3300025944 Ga0207661_10003174 Ga0207661_1000317414 225
99 3300025949 Ga0207667_10000745 Ga0207667_100007453 225
100 3300026142 Ga0207698_10262291 Ga0207698_102622912 225
101 3300042876 Ga0451577_0020593 Ga0451577_0020593_4087_4788 226
102 3300044712 Ga0453684_0000626 Ga0453684_0000626_60743_61444 226
103 3300005341 Ga0070691_10018495 Ga0070691_100184954 227
104 3300009176 Ga0105242_10369221 Ga0105242_103692212 227
105 3300013297 Ga0157378_10771966 Ga0157378_107719661 227
106 3300053139 Ga0500568_0113664 Ga0500568_0113664_43_732 228
107 3300003323 rootH1_10083436 rootH1_100834361 229
108 3300013296 Ga0157374_10662822 Ga0157374_106628222 235
109 3300049652 Ga0501202_002974 Ga0501202_002974_1361_2083 237
110 3300049761 Ga0501264_000224 Ga0501264_000224_402_1124 237
111 3300003316 rootH1_10001324 rootH1_100013242 238
112 3300003320 rootH2_10003834 rootH2_1000383410 238
113 3300003322 rootL2_10008987 rootL2_100089872 238
114 3300003323 rootH1_10013570 rootH1_100135709 238
115 3300028666 Ga0265336_10034237 Ga0265336_100342372 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

64

245

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9744 16 235
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9742 16 235
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9131 16 235
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9129 16 235
1oe6-assembly1.cif.gz_A xenopus smug1, an anti-mutator uracil-dna glycosylase 0.7678 19 235
ID Description Score Start End Superfamily
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7844 18 234 3.40.470.10
af_Q9VEM1_36_278_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7548 19 234 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.736 19 238 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7301 19 238 3.40.470.10
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7197 18 234 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A385SDU8-F1-model_v4 DUF4918 family protein 0.9965 17 237
AF-A0A6N4EE79-F1-model_v4 deleted 0.9929 137 234
AF-A0A7V4YUY9-F1-model_v4 DUF4918 family protein 0.9893 83 233
AF-A0A385SDU8-F1-model_v4 DUF4918 family protein 0.9876 17 237
AF-A0A081SIB8-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9872 17 234

Feature Viewer

pLDDT pTM Quality
91.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map