F076391

General Info

Members Datasets Scaffolds Average Seq Length
113 87 226 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2974315732|2974319368
Length 210
Sequence TGEGVHTPPATCPAASSIGVGGRVQNHPVTRTTYFTASTLDGYLADENDSLEWLFRQDIDEHGPMNYGDFIADIGAIVMGATTYAWVLEHNASTGEAWTYDMPAWVVTHRDFADSEHDVRFAAGDVADLWPAIEESAGGKDVWIVGGGDLAAQFAQAGHLDRIVVSIAPVTLGAGRPLFPRRFDLRLVDFARNGAFLCAEYDVVEPHAQT

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
3 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
4 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
5 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
6 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
36 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
37 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
38 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
39 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
40 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
41 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
42 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
43 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
44 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
45 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
46 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
47 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
54 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
57 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
58 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
59 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
60 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
61 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
62 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
63 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
64 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
65 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
66 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
67 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
68 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
69 2508501039 Frankia saprophytica CN3 Isolate Nodule
70 2517572101 Frankia sp. DC12 Isolate Nodule
71 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
72 2643221576 Nocardioides sp. Root614 Isolate Unclassified
73 2643221590 Nocardioides sp. Root682 Isolate Unclassified
74 2643221604 Nocardioides sp. Root190 Isolate Unclassified
75 2643221617 Nocardioides sp. Root79 Isolate Unclassified
76 2643221620 Nocardioides sp. Root240 Isolate Unclassified
77 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
78 2687453737 Frankia sp. BMG5.36 Isolate Nodule
79 2738541305 Nocardioides sp. CF167 Isolate Unclassified
80 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
81 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
82 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
83 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
84 2920879853 Kocuria salina CV6 Isolate Unclassified
85 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
86 8002775197 Frankia nepalensis CN7 Isolate Nodule
87 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.3
Metatranscriptomes 0
Isolates 17.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.88
Bulb 0
Endosphere 16.81
Nodule 6.19
Rhizoplane 2.65
Rhizosphere 53.1
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100328686 3300005543 Bacteria 1300
2 Ga0068859_100000027 3300005617 Bacteria 182371
3 Ga0068859_100007718 3300005617 Bacteria 10927
4 Ga0068863_100023214 3300005841 Bacteria 5928
5 Ga0068858_100098956 3300005842 Bacteria 2719
6 Ga0068860_100000314 3300005843 Bacteria 66294
7 Ga0068862_100000186 3300005844 Bacteria 68544
8 Ga0081455_10000186 3300005937 Bacteria 78624
9 Ga0075365_10024783 3300006038 Bacteria 3791
10 Ga0075365_10239768 3300006038 Bacteria 1273
11 Ga0075365_10519660 3300006038 Bacteria 842
12 Ga0075364_10019568 3300006051 Bacteria 4249
13 Ga0075364_10064103 3300006051 Bacteria 2412
14 Ga0075364_10075541 3300006051 Bacteria 2223
15 Ga0075430_100043170 3300006846 Bacteria 3811
16 Ga0075431_100320952 3300006847 Bacteria 1562
17 Ga0075429_100091373 3300006880 Bacteria 2656
18 Ga0097620_100000027 3300006931 Bacteria 182371
19 Ga0097620_100007718 3300006931 Bacteria 10927
20 Ga0111539_10432580 3300009094 Bacteria 1532
21 Ga0114129_10154666 3300009147 Bacteria 3137
22 Ga0114129_10438929 3300009147 Bacteria 1714
23 Ga0105248_10000460 3300009177 Bacteria 46329
24 Ga0105249_10014658 3300009553 Bacteria 6928
25 Ga0105246_11307887 3300011119 Bacteria 672
26 Ga0157375_10089446 3300013308 Bacteria 3135
27 Ga0163163_10012027 3300014325 Bacteria 7876
28 Ga0157380_10388700 3300014326 Bacteria 1319
29 Ga0157380_11090816 3300014326 Bacteria 837
30 Ga0163161_10569017 3300017792 Bacteria 931
31 Ga0207654_10350538 3300025911 Unclassified 1016
32 Ga0207711_10000314 3300025941 Bacteria 51767
33 Ga0207712_10007412 3300025961 Bacteria 6927
34 Ga0207703_10037965 3300026035 Bacteria 3840
35 Ga0207641_11501145 3300026088 Bacteria 675
36 Ga0207675_100413966 3300026118 Bacteria 1330
37 Ga0207675_101833122 3300026118 Bacteria 626
38 Ga0268265_10000206 3300028380 Bacteria 68565
39 Ga0268264_10000531 3300028381 Bacteria 48262
40 Ga0395899_0202168 3300037312 Bacteria 1385
41 Ga0395899_0244140 3300037312 Bacteria 1235
42 Ga0395900_0239176 3300037418 Bacteria 1822
43 Ga0395901_0043824 3300038443 Bacteria 4641
44 Ga0466965_0013767 3300044683 Bacteria 3822
45 Ga0466965_0076929 3300044683 Bacteria 1684
46 Ga0466965_0120082 3300044683 Bacteria 1357
47 Ga0466965_0210696 3300044683 Bacteria 1033
48 Ga0466965_0331744 3300044683 Bacteria 830
49 Ga0466964_0285586 3300044706 Bacteria 826
50 Ga0496102_0087132 3300048905 Bacteria 2885
51 Ga0496102_0204867 3300048905 Bacteria 1860
52 Ga0496114_1072811 3300048917 Bacteria 690
53 Ga0496116_0000246 3300048919 Bacteria 98506
54 Ga0496117_0002747 3300048920 Bacteria 21574
55 Ga0496117_0017632 3300048920 Bacteria 5957
56 Ga0496117_0195626 3300048920 Bacteria 1147
57 Ga0496118_0009015 3300048921 Bacteria 10176
58 Ga0496118_0009935 3300048921 Bacteria 9504
59 Ga0496118_0034725 3300048921 Bacteria 4108
60 Ga0496119_0010505 3300048922 Bacteria 7782
61 Ga0496121_0013026 3300048924 Bacteria 8982
62 Ga0496122_0215885 3300048925 Bacteria 1106
63 Ga0496125_0060976 3300048928 Bacteria 3028
64 Ga0496126_0002565 3300048929 Bacteria 24296
65 Ga0501032_0157217 3300049569 Bacteria 1493
66 Ga0501034_1021239 3300049571 Bacteria 710
67 Ga0501037_0311488 3300049573 Bacteria 1091
68 Ga0501039_0097372 3300049575 Bacteria 2294
69 Ga0501040_0025632 3300049576 Bacteria 3966
70 Ga0501046_0367818 3300049580 Bacteria 1042
71 Ga0501048_0471948 3300049582 Bacteria 899
72 Ga0501071_0074180 3300049587 Bacteria 2483
73 Ga0501074_0186838 3300049590 Bacteria 1478
74 Ga0501076_0484658 3300049592 Bacteria 1019
75 Ga0501079_0458668 3300049741 Bacteria 1001
76 nmdc:mga03n38_195807_c1 3300050490 Bacteria 1043
77 nmdc:mga03n38_453822_c1 3300050490 Bacteria 713
78 nmdc:mga00v17_47811_c1 3300050491 Bacteria 2592
79 nmdc:mga00v17_80702_c1 3300050491 Bacteria 2030
80 nmdc:mga00v17_93285_c1 3300050491 Bacteria 1893
81 nmdc:mga0yw44_259710_c2 3300050492 Bacteria 789
82 nmdc:mga0yw44_4459_c1 3300050492 Bacteria 6424
83 nmdc:mga0yw44_638868_c1 3300050492 Bacteria 723
84 nmdc:mga0yw44_75135_c1 3300050492 Bacteria 2106
85 nmdc:mga05p37_448472_c1 3300050507 Bacteria 1494
86 nmdc:mga05p37_581111_c1 3300050507 Bacteria 1269
87 nmdc:mga09592_75615_c1 3300050508 Bacteria 2863
88 nmdc:mga0qj67_94019_c1 3300050509 Unclassified 2411
89 nmdc:mga06r32_311370_c1 3300050510 Bacteria 1560
90 Ga0500643_000240 3300053087 Bacteria 50980
91 Ga0500556_0000662 3300053104 Bacteria 21438
92 Ga0500593_001686 3300053117 Bacteria 7975
93 Ga0500568_0059421 3300053139 Bacteria 1483
94 2974319368 2974315732 Bacteria 4602776
95 2508674389 2508501039 Bacteria 9978592
96 2517764444 2517572101 Bacteria 6884336
97 2523386987 2523231044 Bacteria 6434991
98 2643892248 2643221576 Bacteria 5214352
99 2643961299 2643221590 Bacteria 5214697
100 2644033367 2643221604 Bacteria 5014917
101 2644098315 2643221617 Bacteria 5139111
102 2644118958 2643221620 Bacteria 5134593
103 2676199169 2675902999 Bacteria 9438463
104 2689961725 2687453737 Bacteria 11203906
105 2738869251 2738541305 Bacteria 4910150
106 2774843747 2773857921 Bacteria 9435764
107 2812331336 2811994874 Bacteria 5367947
108 2837184008 2837183177 Bacteria 4637169
109 2842888973 2842888712 Bacteria 4279094
110 2920880207 2920879853 Bacteria 4216831
111 2984527576 2984523437 Bacteria 4508481
112 8002780707 8002775197 Bacteria 10728764
113 8002787746 8002784119 Bacteria 9788632
114 Ga0070672_100328686
115 Ga0068859_100000027
116 Ga0068859_100007718
117 Ga0068863_100023214
118 Ga0068858_100098956
119 Ga0068860_100000314
120 Ga0068862_100000186
121 Ga0081455_10000186
122 Ga0075365_10024783
123 Ga0075365_10239768
124 Ga0075365_10519660
125 Ga0075364_10019568
126 Ga0075364_10064103
127 Ga0075364_10075541
128 Ga0075430_100043170
129 Ga0075431_100320952
130 Ga0075429_100091373
131 Ga0097620_100000027
132 Ga0097620_100007718
133 Ga0111539_10432580
134 Ga0114129_10154666
135 Ga0114129_10438929
136 Ga0105248_10000460
137 Ga0105249_10014658
138 Ga0105246_11307887
139 Ga0157375_10089446
140 Ga0163163_10012027
141 Ga0157380_10388700
142 Ga0157380_11090816
143 Ga0163161_10569017
144 Ga0207654_10350538
145 Ga0207711_10000314
146 Ga0207712_10007412
147 Ga0207703_10037965
148 Ga0207641_11501145
149 Ga0207675_100413966
150 Ga0207675_101833122
151 Ga0268265_10000206
152 Ga0268264_10000531
153 Ga0395899_0202168
154 Ga0395899_0244140
155 Ga0395900_0239176
156 Ga0395901_0043824
157 Ga0466965_0013767
158 Ga0466965_0076929
159 Ga0466965_0120082
160 Ga0466965_0210696
161 Ga0466965_0331744
162 Ga0466964_0285586
163 Ga0496102_0087132
164 Ga0496102_0204867
165 Ga0496114_1072811
166 Ga0496116_0000246
167 Ga0496117_0002747
168 Ga0496117_0017632
169 Ga0496117_0195626
170 Ga0496118_0009015
171 Ga0496118_0009935
172 Ga0496118_0034725
173 Ga0496119_0010505
174 Ga0496121_0013026
175 Ga0496122_0215885
176 Ga0496125_0060976
177 Ga0496126_0002565
178 Ga0501032_0157217
179 Ga0501034_1021239
180 Ga0501037_0311488
181 Ga0501039_0097372
182 Ga0501040_0025632
183 Ga0501046_0367818
184 Ga0501048_0471948
185 Ga0501071_0074180
186 Ga0501074_0186838
187 Ga0501076_0484658
188 Ga0501079_0458668
189 nmdc:mga03n38_195807_c1
190 nmdc:mga03n38_453822_c1
191 nmdc:mga00v17_47811_c1
192 nmdc:mga00v17_80702_c1
193 nmdc:mga00v17_93285_c1
194 nmdc:mga0yw44_259710_c2
195 nmdc:mga0yw44_4459_c1
196 nmdc:mga0yw44_638868_c1
197 nmdc:mga0yw44_75135_c1
198 nmdc:mga05p37_448472_c1
199 nmdc:mga05p37_581111_c1
200 nmdc:mga09592_75615_c1
201 nmdc:mga0qj67_94019_c1
202 nmdc:mga06r32_311370_c1
203 Ga0500643_000240
204 Ga0500556_0000662
205 Ga0500593_001686
206 Ga0500568_0059421
207 2974319368
208 2508674389
209 2517764444
210 2523386987
211 2643892248
212 2643961299
213 2644033367
214 2644098315
215 2644118958
216 2676199169
217 2689961725
218 2738869251
219 2774843747
220 2812331336
221 2837184008
222 2842888973
223 2920880207
224 2984527576
225 8002780707
226 8002787746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

31

194

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.9558 2 175
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.924 2 175
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.9162 1 176
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.9112 1 176
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8397 1 175
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9558 2 175 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.924 2 175 3.40.430.10
3cb0C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8359 156 178 2.30.110.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8303 1 175 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8177 4 175 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538D734-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9805 1 177 GO:0008703
GO:0009231
GO:0016020
AF-A0A543BNJ4-F1-model_v4 Dihydrofolate reductase 0.9784 2 177 GO:0008703
GO:0009231
AF-A0A838LMQ2-F1-model_v4 Dihydrofolate reductase family protein 0.978 2 179 GO:0008703
GO:0009231
AF-A0A538DJK4-F1-model_v4 Dihydrofolate reductase 0.9738 75 177 GO:0008703
GO:0009231
AF-A0A7I9V5X5-F1-model_v4 Dihydrofolate reductase 0.9716 1 179 GO:0008703
GO:0009231

Map