F073928

General Info

Members Datasets Scaffolds Average Seq Length
113 81 226 215

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_11081626|Ga0157374_110816261
Length 196
Sequence MSTKSEIISRLTDPGIIAVVRAQKAEQVIPLSEALLAGGVIVIEITMTTPNAIAAIRDARQKLGDRALIGVGTVLDLDTCRSALDAGAEFVVTPVLRPEFAQAAHEAGADFIKIFPADTLGPGYIKGIRAPLPHLRIVPTGGVDVHNVADFLKAGCAALGVGSSLVSAKILQDANWSELTRKAAEFVAAARQAKAK

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
46 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
47 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
53 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 23.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_11081626 3300013296 Unclassified 822
2 rootH2_10010569 3300003320 Unclassified 1576
3 Ga0070680_100465411 3300005336 Bacteria 1080
4 Ga0070689_100044021 3300005340 Bacteria 3434
5 Ga0070689_100063947 3300005340 Bacteria 2863
6 Ga0070671_100683885 3300005355 Bacteria 889
7 Ga0070713_100529820 3300005436 Bacteria 1114
8 Ga0070711_100140506 3300005439 Bacteria 1810
9 Ga0070686_100024722 3300005544 Bacteria 3603
10 Ga0070704_100277368 3300005549 Bacteria 1387
11 Ga0068857_100001426 3300005577 Bacteria 18927
12 Ga0068857_101014373 3300005577 Bacteria 799
13 Ga0070702_100153479 3300005615 Bacteria 1481
14 Ga0070702_100208306 3300005615 Bacteria 1299
15 Ga0068859_100111750 3300005617 Bacteria 2795
16 Ga0068863_100078127 3300005841 Bacteria 3134
17 Ga0068862_101245790 3300005844 Bacteria 744
18 Ga0081455_10056138 3300005937 Bacteria 3345
19 Ga0097621_100043808 3300006237 Bacteria 3609
20 Ga0097621_100114332 3300006237 Bacteria 2283
21 Ga0097621_100835813 3300006237 Unclassified 855
22 Ga0068871_100034884 3300006358 Bacteria 3995
23 Ga0068865_100369822 3300006881 Bacteria 1166
24 Ga0097620_100111743 3300006931 Bacteria 2795
25 Ga0075435_100691447 3300007076 Unclassified 886
26 Ga0099795_10031091 3300007788 Bacteria 1836
27 Ga0105240_10006802 3300009093 Bacteria 16723
28 Ga0105240_10514545 3300009093 Bacteria 1329
29 Ga0111539_10591420 3300009094 Bacteria 1292
30 Ga0111539_10894957 3300009094 Unclassified 1032
31 Ga0111539_11299372 3300009094 Bacteria 844
32 Ga0105248_11474880 3300009177 Unclassified 770
33 Ga0157374_10230129 3300013296 Bacteria 1821
34 Ga0157374_10280688 3300013296 Bacteria 1644
35 Ga0157374_10378212 3300013296 Bacteria 1410
36 Ga0157378_10333241 3300013297 Unclassified 1477
37 Ga0163163_10007622 3300014325 Bacteria 9563
38 Ga0157376_10864634 3300014969 Bacteria 920
39 Ga0207695_10072869 3300025913 Bacteria 3502
40 Ga0207695_10368142 3300025913 Bacteria 1323
41 Ga0207646_10823319 3300025922 Bacteria 826
42 Ga0207670_10031702 3300025936 Bacteria 3391
43 Ga0207670_10058541 3300025936 Bacteria 2618
44 Ga0207670_10163670 3300025936 Bacteria 1663
45 Ga0207670_10201407 3300025936 Bacteria 1513
46 Ga0207711_11189324 3300025941 Unclassified 704
47 Ga0207674_10003551 3300026116 Bacteria 19031
48 Ga0265337_1003921 3300028556 Bacteria 6300
49 Ga0265336_10071223 3300028666 Bacteria 1039
50 Ga0265338_10000008 3300028800 Bacteria 481542
51 Ga0265338_10000269 3300028800 Bacteria 95081
52 Ga0265338_10141516 3300028800 Bacteria 1884
53 Ga0265324_10000975 3300029957 Bacteria 17727
54 Ga0265324_10042376 3300029957 Unclassified 1573
55 Ga0265328_10071605 3300031239 Bacteria 1274
56 Ga0265320_10219893 3300031240 Unclassified 846
57 Ga0265339_10025191 3300031249 Bacteria 3418
58 Ga0307408_100201013 3300031548 Unclassified 1613
59 Ga0316576_10059998 3300031727 Unclassified 2786
60 Ga0307405_10242542 3300031731 Bacteria 1336
61 Ga0316577_10256109 3300031733 Bacteria 990
62 Ga0307410_10135848 3300031852 Unclassified 1813
63 Ga0373926_0008165 3300035083 Bacteria 3486
64 Ga0373936_0139316 3300035113 Bacteria 1047
65 Ga0373955_0290715 3300035172 Unclassified 984
66 Ga0373935_0076982 3300035692 Bacteria 2161
67 Ga0316582_0235228 3300036647 Bacteria 1254
68 Ga0316584_0069921 3300036712 Bacteria 2632
69 Ga0373925_0004089 3300037068 Bacteria 11075
70 Ga0451807_0529384 3300041486 Bacteria 2100
71 Ga0451851_1113320 3300041507 Bacteria 715
72 Ga0451853_0157660 3300041512 Unclassified 614
73 Ga0451577_0002666 3300042876 Bacteria 20857
74 Ga0451577_0131455 3300042876 Bacteria 2245
75 Ga0451577_0385516 3300042876 Bacteria 1272
76 Ga0453684_0085642 3300044712 Unclassified 3914
77 Ga0451576_0022800 3300045051 Bacteria 6782
78 Ga0451576_0115378 3300045051 Bacteria 2796
79 Ga0451576_0374317 3300045051 Bacteria 1492
80 Ga0451576_0528798 3300045051 Unclassified 1239
81 Ga0451576_0554532 3300045051 Unclassified 1207
82 Ga0451576_1525353 3300045051 Unclassified 694
83 Ga0495592_0041484 3300046454 Bacteria 3449
84 Ga0495592_0348496 3300046454 Bacteria 950
85 Ga0495580_0518163 3300046472 Unclassified 795
86 Ga0495639_0237459 3300046475 Bacteria 899
87 Ga0495628_0171236 3300046516 Bacteria 1646
88 Ga0495628_0325676 3300046516 Bacteria 1133
89 Ga0495630_0081817 3300046517 Bacteria 2437
90 Ga0495630_0262230 3300046517 Unclassified 1320
91 Ga0495666_0051873 3300046526 Unclassified 1970
92 Ga0495652_0278101 3300046529 Bacteria 1227
93 Ga0495586_0043094 3300046535 Bacteria 2431
94 Ga0495586_0398718 3300046535 Unclassified 792
95 Ga0495645_0126550 3300046543 Bacteria 1795
96 Ga0495667_0230882 3300046559 Bacteria 1180
97 Ga0495634_0021156 3300046642 Bacteria 4603
98 Ga0495635_0534108 3300046663 Bacteria 770
99 Ga0495657_0412243 3300046675 Bacteria 794
100 Ga0495599_0339077 3300046678 Bacteria 903
101 Ga0495599_0409858 3300046678 Bacteria 806
102 Ga0495647_0094666 3300046681 Bacteria 1229
103 Ga0495613_0297449 3300046689 Bacteria 1118
104 Ga0495613_0332459 3300046689 Bacteria 1047
105 Ga0495624_0332474 3300046690 Bacteria 914
106 Ga0495676_0135557 3300047321 Unclassified 1771
107 Ga0495675_0300613 3300047444 Bacteria 953
108 Ga0495684_0320737 3300047471 Bacteria 1108
109 Ga0496112_0697363 3300048915 Unclassified 943
110 nmdc:mga06r32_433131_c1 3300050510 Bacteria 1296
111 nmdc:mga06r32_45376_c1 3300050510 Bacteria 4189
112 nmdc:mga08y16_418471_c1 3300050511 Unclassified 1370
113 Ga0495601_0281093 3300053077 Bacteria 1085
114 Ga0157374_11081626
115 rootH2_10010569
116 Ga0070680_100465411
117 Ga0070689_100044021
118 Ga0070689_100063947
119 Ga0070671_100683885
120 Ga0070713_100529820
121 Ga0070711_100140506
122 Ga0070686_100024722
123 Ga0070704_100277368
124 Ga0068857_100001426
125 Ga0068857_101014373
126 Ga0070702_100153479
127 Ga0070702_100208306
128 Ga0068859_100111750
129 Ga0068863_100078127
130 Ga0068862_101245790
131 Ga0081455_10056138
132 Ga0097621_100043808
133 Ga0097621_100114332
134 Ga0097621_100835813
135 Ga0068871_100034884
136 Ga0068865_100369822
137 Ga0097620_100111743
138 Ga0075435_100691447
139 Ga0099795_10031091
140 Ga0105240_10006802
141 Ga0105240_10514545
142 Ga0111539_10591420
143 Ga0111539_10894957
144 Ga0111539_11299372
145 Ga0105248_11474880
146 Ga0157374_10230129
147 Ga0157374_10280688
148 Ga0157374_10378212
149 Ga0157378_10333241
150 Ga0163163_10007622
151 Ga0157376_10864634
152 Ga0207695_10072869
153 Ga0207695_10368142
154 Ga0207646_10823319
155 Ga0207670_10031702
156 Ga0207670_10058541
157 Ga0207670_10163670
158 Ga0207670_10201407
159 Ga0207711_11189324
160 Ga0207674_10003551
161 Ga0265337_1003921
162 Ga0265336_10071223
163 Ga0265338_10000008
164 Ga0265338_10000269
165 Ga0265338_10141516
166 Ga0265324_10000975
167 Ga0265324_10042376
168 Ga0265328_10071605
169 Ga0265320_10219893
170 Ga0265339_10025191
171 Ga0307408_100201013
172 Ga0316576_10059998
173 Ga0307405_10242542
174 Ga0316577_10256109
175 Ga0307410_10135848
176 Ga0373926_0008165
177 Ga0373936_0139316
178 Ga0373955_0290715
179 Ga0373935_0076982
180 Ga0316582_0235228
181 Ga0316584_0069921
182 Ga0373925_0004089
183 Ga0451807_0529384
184 Ga0451851_1113320
185 Ga0451853_0157660
186 Ga0451577_0002666
187 Ga0451577_0131455
188 Ga0451577_0385516
189 Ga0453684_0085642
190 Ga0451576_0022800
191 Ga0451576_0115378
192 Ga0451576_0374317
193 Ga0451576_0528798
194 Ga0451576_0554532
195 Ga0451576_1525353
196 Ga0495592_0041484
197 Ga0495592_0348496
198 Ga0495580_0518163
199 Ga0495639_0237459
200 Ga0495628_0171236
201 Ga0495628_0325676
202 Ga0495630_0081817
203 Ga0495630_0262230
204 Ga0495666_0051873
205 Ga0495652_0278101
206 Ga0495586_0043094
207 Ga0495586_0398718
208 Ga0495645_0126550
209 Ga0495667_0230882
210 Ga0495634_0021156
211 Ga0495635_0534108
212 Ga0495657_0412243
213 Ga0495599_0339077
214 Ga0495599_0409858
215 Ga0495647_0094666
216 Ga0495613_0297449
217 Ga0495613_0332459
218 Ga0495624_0332474
219 Ga0495676_0135557
220 Ga0495675_0300613
221 Ga0495684_0320737
222 Ga0496112_0697363
223 nmdc:mga06r32_433131_c1
224 nmdc:mga06r32_45376_c1
225 nmdc:mga08y16_418471_c1
226 Ga0495601_0281093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

102

182

0.95

PF01081

Aldolase

KDPG and KHG aldolase

7

109

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8di1-assembly1.cif.gz_A bfo2294: tannerella forsythia 2-keto-3-deoxy-6-phosphogluconate aldolase (kdpg) and 4-hydroxy-2-oxoglutarate aldolase (khg) 0.9532 2 213
6p6f-assembly1.cif.gz_A bg505 sosip-i53-50np 0.9532 8 212
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9519 10 212
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9483 7 212
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9477 8 211
ID Description Score Start End Superfamily
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9572 44 209 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9537 5 217 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9499 4 213 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9325 5 217 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9322 4 213 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A832HSI6-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase 0.9926 1 215 GO:0016829
AF-A0A1V6DY95-F1-model_v4 deleted 0.9926 1 215
AF-A0A2G4I8K0-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9892 1 213 GO:0016829
AF-A0A1H2EUM2-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase 0.9892 2 216 GO:0016829
AF-B4D6K9-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase 0.9891 2 214 GO:0016829

Map