F069911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 112 | 27 | 224 | 437 |
Family's Representative Sequence
| Representative Sequence | 3300033528|Ga0316588_1005274|Ga0316588_10052741 |
| Length | 477 |
| Sequence | VVSGAHGHSPYLYVFDDPVMMIKRKANSEMISRPEERFDSGGAVKSSLGWKNNRSSFGNLLLHIHPRSLPERNLKFSHTWGLGGAALMLVLLQAFTGILLLFVFQPVPEKAYDSVRTLMDQVLFGSFIRNMHYWSANLLVVVVLLHMLRVFYTDAFHAPRRFNWVVGLCLFGFVLISNFTGYLLPWDQLSYWAVTISTGMLEYMPLFGTTLQNFIRGGTEMGPATLSNFFVFHMVVMPVCFLLFLPFHFWRIRKDGGVVRPRAAGTEAAPPVRMVPAMPDLVIREISLGLVVAAVIFLLAAFFDAPLGDSANPGLSPNPTKAPWYFMGLQELMLHFHPLFAVFIIPLVLVGLLIYLPYFRYDSDMPGIWFRSGKGRRSAIAAALAALMITPVWILADEYFLDFESWFPNLPPAVSNGLLPVGFIAIILAGGYRLVRKKYSNTNNEAIQALFVFLLVALMVLTAFGIWLRGEGMVLSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 3 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 4 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 5 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 6 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 7 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 8 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 9 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 10 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 13 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 14 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 15 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 16 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 17 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 18 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 19 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 20 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 21 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 22 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 23 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 24 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 25 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 26 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 27 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.43 |
| Metatranscriptomes | 3.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316588_1005274 | 3300033528 | Bacteria | 2505 |
| 2 | Ga0316575_10002929 | 3300031665 | Bacteria | 5809 |
| 3 | Ga0316575_10010480 | 3300031665 | Bacteria | 3408 |
| 4 | Ga0316575_10044602 | 3300031665 | Bacteria | 1759 |
| 5 | Ga0316575_10044650 | 3300031665 | Unclassified | 1759 |
| 6 | Ga0316579_10000377 | 3300031691 | Bacteria | 14083 |
| 7 | Ga0316579_10006330 | 3300031691 | Bacteria | 4827 |
| 8 | Ga0316579_10007677 | 3300031691 | Bacteria | 4465 |
| 9 | Ga0316579_10014139 | 3300031691 | Bacteria | 3443 |
| 10 | Ga0316579_10044766 | 3300031691 | Bacteria | 2062 |
| 11 | Ga0316576_10000213 | 3300031727 | Bacteria | 24429 |
| 12 | Ga0316576_10012751 | 3300031727 | Bacteria | 5561 |
| 13 | Ga0316576_10022260 | 3300031727 | Bacteria | 4399 |
| 14 | Ga0316576_10041689 | 3300031727 | Bacteria | 3306 |
| 15 | Ga0316576_10042555 | 3300031727 | Bacteria | 3274 |
| 16 | Ga0316576_10049130 | 3300031727 | Bacteria | 3062 |
| 17 | Ga0316576_10053227 | 3300031727 | Bacteria | 2949 |
| 18 | Ga0316576_10053471 | 3300031727 | Bacteria | 2942 |
| 19 | Ga0316576_10062040 | 3300031727 | Bacteria | 2740 |
| 20 | Ga0316576_10082381 | 3300031727 | Unclassified | 2389 |
| 21 | Ga0316576_10150638 | 3300031727 | Bacteria | 1752 |
| 22 | Ga0316578_10000853 | 3300031728 | Bacteria | 11439 |
| 23 | Ga0316578_10001281 | 3300031728 | Bacteria | 10057 |
| 24 | Ga0316578_10019076 | 3300031728 | Bacteria | 3769 |
| 25 | Ga0316578_10019407 | 3300031728 | Bacteria | 3741 |
| 26 | Ga0316578_10021408 | 3300031728 | Bacteria | 3588 |
| 27 | Ga0316578_10098722 | 3300031728 | Archaea | 1749 |
| 28 | Ga0316578_10114279 | 3300031728 | Bacteria | 1622 |
| 29 | Ga0316577_10001569 | 3300031733 | Bacteria | 10876 |
| 30 | Ga0316577_10001932 | 3300031733 | Bacteria | 10045 |
| 31 | Ga0316577_10010429 | 3300031733 | Bacteria | 5016 |
| 32 | Ga0316577_10027706 | 3300031733 | Unclassified | 3159 |
| 33 | Ga0316577_10057660 | 3300031733 | Bacteria | 2168 |
| 34 | Ga0316577_10067306 | 3300031733 | Unclassified | 1999 |
| 35 | Ga0316583_10000992 | 3300032133 | Bacteria | 9126 |
| 36 | Ga0316583_10002689 | 3300032133 | Bacteria | 6209 |
| 37 | Ga0316583_10007343 | 3300032133 | Bacteria | 3969 |
| 38 | Ga0316583_10008545 | 3300032133 | Bacteria | 3693 |
| 39 | Ga0316585_10000798 | 3300032137 | Bacteria | 7940 |
| 40 | Ga0316585_10018030 | 3300032137 | Unclassified | 2139 |
| 41 | Ga0316580_10006268 | 3300032139 | Bacteria | 3510 |
| 42 | Ga0316580_10009082 | 3300032139 | Bacteria | 2987 |
| 43 | Ga0316580_10015153 | 3300032139 | Bacteria | 2357 |
| 44 | Ga0316593_10020418 | 3300032168 | Unclassified | 2060 |
| 45 | Ga0316593_10028039 | 3300032168 | Bacteria | 1812 |
| 46 | Ga0316596_1020345 | 3300033541 | Unclassified | 1687 |
| 47 | Ga0316574_0001783 | 3300035398 | Bacteria | 10461 |
| 48 | Ga0316574_0006004 | 3300035398 | Bacteria | 6524 |
| 49 | Ga0316574_0007306 | 3300035398 | Bacteria | 6048 |
| 50 | Ga0316574_0018665 | 3300035398 | Bacteria | 4081 |
| 51 | Ga0316574_0025170 | 3300035398 | Bacteria | 3570 |
| 52 | Ga0316574_0047622 | 3300035398 | Unclassified | 2662 |
| 53 | Ga0316574_0075607 | 3300035398 | Bacteria | 2133 |
| 54 | Ga0316574_0075940 | 3300035398 | Unclassified | 2128 |
| 55 | Ga0316574_0095202 | 3300035398 | Bacteria | 1902 |
| 56 | Ga0316582_0001040 | 3300036647 | Bacteria | 11605 |
| 57 | Ga0316582_0001167 | 3300036647 | Bacteria | 11220 |
| 58 | Ga0316582_0007597 | 3300036647 | Bacteria | 5779 |
| 59 | Ga0316582_0009395 | 3300036647 | Bacteria | 5308 |
| 60 | Ga0316582_0016088 | 3300036647 | Bacteria | 4295 |
| 61 | Ga0316582_0098343 | 3300036647 | Unclassified | 1935 |
| 62 | Ga0316582_0121550 | 3300036647 | Bacteria | 1747 |
| 63 | Ga0316582_0127367 | 3300036647 | Bacteria | 1708 |
| 64 | Ga0316582_0305262 | 3300036647 | Unclassified | 1094 |
| 65 | Ga0316584_0003677 | 3300036712 | Bacteria | 10032 |
| 66 | Ga0316584_0005302 | 3300036712 | Bacteria | 8633 |
| 67 | Ga0316584_0009140 | 3300036712 | Bacteria | 6863 |
| 68 | Ga0316584_0015624 | 3300036712 | Bacteria | 5431 |
| 69 | Ga0316584_0016019 | 3300036712 | Bacteria | 5369 |
| 70 | Ga0316584_0029323 | 3300036712 | Bacteria | 4061 |
| 71 | Ga0316584_0034891 | 3300036712 | Bacteria | 3730 |
| 72 | Ga0316584_0049284 | 3300036712 | Bacteria | 3148 |
| 73 | Ga0316584_0051144 | 3300036712 | Archaea | 3090 |
| 74 | Ga0316584_0113475 | 3300036712 | Archaea | 2027 |
| 75 | Ga0316584_0174164 | 3300036712 | Bacteria | 1594 |
| 76 | Ga0316581_0014318 | 3300037588 | Bacteria | 2257 |
| 77 | Ga0316581_0015599 | 3300037588 | Bacteria | 2173 |
| 78 | Ga0400484_22567 | 3300038725 | Bacteria | 8217 |
| 79 | Ga0400491_18482 | 3300038727 | Bacteria | 2955 |
| 80 | Ga0400485_08480 | 3300038735 | Bacteria | 12550 |
| 81 | Ga0400485_13804 | 3300038735 | Bacteria | 2412 |
| 82 | Ga0400488_14986 | 3300038741 | Bacteria | 1852 |
| 83 | Ga0400488_15052 | 3300038741 | Bacteria | 2718 |
| 84 | Ga0400488_50346 | 3300038741 | Bacteria | 4420 |
| 85 | Ga0400486_06443 | 3300038742 | Bacteria | 19261 |
| 86 | Ga0400486_25464 | 3300038742 | Bacteria | 13664 |
| 87 | Ga0400486_29644 | 3300038742 | Bacteria | 1155 |
| 88 | Ga0400486_31985 | 3300038742 | Bacteria | 11813 |
| 89 | Ga0400483_069559 | 3300039062 | Bacteria | 57705 |
| 90 | Ga0400483_086750 | 3300039062 | Bacteria | 7280 |
| 91 | Ga0400483_111289 | 3300039062 | Bacteria | 1445 |
| 92 | Ga0400483_228134 | 3300039062 | Bacteria | 119181 |
| 93 | Ga0400483_283884 | 3300039062 | Bacteria | 10714 |
| 94 | Ga0400483_286631 | 3300039062 | Bacteria | 1720 |
| 95 | Ga0400489_41646 | 3300039093 | Bacteria | 7332 |
| 96 | Ga0400489_52247 | 3300039093 | Bacteria | 37995 |
| 97 | Ga0400487_29175 | 3300039110 | Bacteria | 7345 |
| 98 | Ga0451577_0001411 | 3300042876 | Bacteria | 32067 |
| 99 | Ga0451577_0004261 | 3300042876 | Bacteria | 15215 |
| 100 | Ga0451577_0041720 | 3300042876 | Unclassified | 4119 |
| 101 | Ga0453683_0072164 | 3300044673 | Bacteria | 2161 |
| 102 | Ga0453684_0000522 | 3300044712 | Bacteria | 146962 |
| 103 | Ga0453684_0000548 | 3300044712 | Bacteria | 142109 |
| 104 | Ga0453684_0002070 | 3300044712 | Bacteria | 51016 |
| 105 | Ga0453684_0017697 | 3300044712 | Bacteria | 11011 |
| 106 | Ga0453684_0018076 | 3300044712 | Bacteria | 10852 |
| 107 | Ga0453684_0040133 | 3300044712 | Bacteria | 6365 |
| 108 | Ga0453684_0085168 | 3300044712 | Bacteria | 3928 |
| 109 | Ga0453684_0381033 | 3300044712 | Bacteria | 1584 |
| 110 | Ga0453684_0488436 | 3300044712 | Bacteria | 1365 |
| 111 | Ga0451576_0000230 | 3300045051 | Bacteria | 136200 |
| 112 | Ga0451576_0122249 | 3300045051 | Unclassified | 2711 |
| 113 | Ga0316588_1005274 | |||
| 114 | Ga0316575_10002929 | |||
| 115 | Ga0316575_10010480 | |||
| 116 | Ga0316575_10044602 | |||
| 117 | Ga0316575_10044650 | |||
| 118 | Ga0316579_10000377 | |||
| 119 | Ga0316579_10006330 | |||
| 120 | Ga0316579_10007677 | |||
| 121 | Ga0316579_10014139 | |||
| 122 | Ga0316579_10044766 | |||
| 123 | Ga0316576_10000213 | |||
| 124 | Ga0316576_10012751 | |||
| 125 | Ga0316576_10022260 | |||
| 126 | Ga0316576_10041689 | |||
| 127 | Ga0316576_10042555 | |||
| 128 | Ga0316576_10049130 | |||
| 129 | Ga0316576_10053227 | |||
| 130 | Ga0316576_10053471 | |||
| 131 | Ga0316576_10062040 | |||
| 132 | Ga0316576_10082381 | |||
| 133 | Ga0316576_10150638 | |||
| 134 | Ga0316578_10000853 | |||
| 135 | Ga0316578_10001281 | |||
| 136 | Ga0316578_10019076 | |||
| 137 | Ga0316578_10019407 | |||
| 138 | Ga0316578_10021408 | |||
| 139 | Ga0316578_10098722 | |||
| 140 | Ga0316578_10114279 | |||
| 141 | Ga0316577_10001569 | |||
| 142 | Ga0316577_10001932 | |||
| 143 | Ga0316577_10010429 | |||
| 144 | Ga0316577_10027706 | |||
| 145 | Ga0316577_10057660 | |||
| 146 | Ga0316577_10067306 | |||
| 147 | Ga0316583_10000992 | |||
| 148 | Ga0316583_10002689 | |||
| 149 | Ga0316583_10007343 | |||
| 150 | Ga0316583_10008545 | |||
| 151 | Ga0316585_10000798 | |||
| 152 | Ga0316585_10018030 | |||
| 153 | Ga0316580_10006268 | |||
| 154 | Ga0316580_10009082 | |||
| 155 | Ga0316580_10015153 | |||
| 156 | Ga0316593_10020418 | |||
| 157 | Ga0316593_10028039 | |||
| 158 | Ga0316596_1020345 | |||
| 159 | Ga0316574_0001783 | |||
| 160 | Ga0316574_0006004 | |||
| 161 | Ga0316574_0007306 | |||
| 162 | Ga0316574_0018665 | |||
| 163 | Ga0316574_0025170 | |||
| 164 | Ga0316574_0047622 | |||
| 165 | Ga0316574_0075607 | |||
| 166 | Ga0316574_0075940 | |||
| 167 | Ga0316574_0095202 | |||
| 168 | Ga0316582_0001040 | |||
| 169 | Ga0316582_0001167 | |||
| 170 | Ga0316582_0007597 | |||
| 171 | Ga0316582_0009395 | |||
| 172 | Ga0316582_0016088 | |||
| 173 | Ga0316582_0098343 | |||
| 174 | Ga0316582_0121550 | |||
| 175 | Ga0316582_0127367 | |||
| 176 | Ga0316582_0305262 | |||
| 177 | Ga0316584_0003677 | |||
| 178 | Ga0316584_0005302 | |||
| 179 | Ga0316584_0009140 | |||
| 180 | Ga0316584_0015624 | |||
| 181 | Ga0316584_0016019 | |||
| 182 | Ga0316584_0029323 | |||
| 183 | Ga0316584_0034891 | |||
| 184 | Ga0316584_0049284 | |||
| 185 | Ga0316584_0051144 | |||
| 186 | Ga0316584_0113475 | |||
| 187 | Ga0316584_0174164 | |||
| 188 | Ga0316581_0014318 | |||
| 189 | Ga0316581_0015599 | |||
| 190 | Ga0400484_22567 | |||
| 191 | Ga0400491_18482 | |||
| 192 | Ga0400485_08480 | |||
| 193 | Ga0400485_13804 | |||
| 194 | Ga0400488_14986 | |||
| 195 | Ga0400488_15052 | |||
| 196 | Ga0400488_50346 | |||
| 197 | Ga0400486_06443 | |||
| 198 | Ga0400486_25464 | |||
| 199 | Ga0400486_29644 | |||
| 200 | Ga0400486_31985 | |||
| 201 | Ga0400483_069559 | |||
| 202 | Ga0400483_086750 | |||
| 203 | Ga0400483_111289 | |||
| 204 | Ga0400483_228134 | |||
| 205 | Ga0400483_283884 | |||
| 206 | Ga0400483_286631 | |||
| 207 | Ga0400489_41646 | |||
| 208 | Ga0400489_52247 | |||
| 209 | Ga0400487_29175 | |||
| 210 | Ga0451577_0001411 | |||
| 211 | Ga0451577_0004261 | |||
| 212 | Ga0451577_0041720 | |||
| 213 | Ga0453683_0072164 | |||
| 214 | Ga0453684_0000522 | |||
| 215 | Ga0453684_0000548 | |||
| 216 | Ga0453684_0002070 | |||
| 217 | Ga0453684_0017697 | |||
| 218 | Ga0453684_0018076 | |||
| 219 | Ga0453684_0040133 | |||
| 220 | Ga0453684_0085168 | |||
| 221 | Ga0453684_0381033 | |||
| 222 | Ga0453684_0488436 | |||
| 223 | Ga0451576_0000230 | |||
| 224 | Ga0451576_0122249 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2c-assembly1.cif.gz_A | crystal structure of cytochrome b6f complex with dbmib from m. laminosus | 0.9446 | 65 | 239 |
| 1vf5-assembly1.cif.gz_A | crystal structure of cytochrome b6f complex from m.laminosus | 0.8962 | 39 | 236 |
| 2e74-assembly1.cif.gz_A | crystal structure of the cytochrome b6f complex from m.laminosus | 0.8834 | 36 | 240 |
| 4h44-assembly1.cif.gz_A | 2.70 a cytochrome b6f complex structure from nostoc pcc 7120 | 0.8744 | 35 | 240 |
| 1q90-assembly1.cif.gz_B | structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii | 0.8737 | 35 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e76A00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9514 | 52 | 240 | 1.20.810.10 |
| 2d2cA00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9446 | 65 | 239 | 1.20.810.10 |
| 1vf5A00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8962 | 39 | 236 | 1.20.810.10 |
| af_P05642_1_215_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8764 | 35 | 240 | 1.20.810.10 |
| 1vf5A00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8457 | 39 | 236 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A8CCZ3-F1-model_v4 | Cytochrome b6 | 0.9782 | 63 | 191 |
GO:0009055
GO:0009536 GO:0016020 GO:0016491 GO:0022904 |
| AF-A0A2K2DVB0-F1-model_v4 | Cytochrome b/b6 N-terminal region profile domain-containing protein | 0.9775 | 63 | 189 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 |
| AF-A0A7V9ZC11-F1-model_v4 | Cytochrome b N-terminal domain-containing protein | 0.9766 | 63 | 188 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 |
| AF-A8CCZ1-F1-model_v4 | Cytochrome b6 | 0.9729 | 63 | 217 |
GO:0009055
GO:0009536 GO:0016020 GO:0016491 GO:0022904 |
| AF-A0A0B0I5F4-F1-model_v4 | deleted | 0.9694 | 69 | 237 |
|