F069727

General Info

Members Datasets Scaffolds Average Seq Length
112 74 224 191

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10215057|Ga0265327_102150571
Length 214
Sequence MRPTPVIRHPSQPMILSVVKYGNPVLRQKGARIESITPETKQLIADMLETMKASNGVGLAAQQVGRAVQLTVIDVREVKDRPSTLELKGKPADVNQIMPLVLINPEVTAVGEPATGGEGCLSFPEMFAEITRPESVDVKALDEKGKVVEFRAGGLLARAVQHETDHLNGILFIDRMERKKKEEFRDELDALQAATKAELEVARKNKKSRPDLSS

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
69 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
70 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
71 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
72 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
73 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
74 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 0
Rhizosphere 99.11
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10215057 3300031251 Unclassified 866
2 Ga0065704_10014339 3300005289 Unclassified 2210
3 Ga0065707_10641011 3300005295 Unclassified 666
4 Ga0070658_10558987 3300005327 Bacteria 990
5 Ga0070689_100007377 3300005340 Bacteria 7681
6 Ga0070689_100194869 3300005340 Bacteria 1651
7 Ga0070689_100307390 3300005340 Bacteria 1321
8 Ga0070687_100075643 3300005343 Bacteria 1821
9 Ga0070668_100219959 3300005347 Bacteria 1566
10 Ga0070675_100068161 3300005354 Bacteria 2946
11 Ga0070688_100015331 3300005365 Unclassified 4359
12 Ga0070714_100009418 3300005435 Bacteria 7679
13 Ga0070701_10013126 3300005438 Bacteria 3759
14 Ga0070694_100001632 3300005444 Bacteria 13170
15 Ga0070694_100485939 3300005444 Bacteria 980
16 Ga0070685_10140070 3300005466 Bacteria 1522
17 Ga0070685_10271700 3300005466 Unclassified 1131
18 Ga0070685_10475846 3300005466 Unclassified 879
19 Ga0070686_100014277 3300005544 Bacteria 4576
20 Ga0070695_100219982 3300005545 Unclassified 1368
21 Ga0070704_100405409 3300005549 Bacteria 1164
22 Ga0070704_100446802 3300005549 Bacteria 1112
23 Ga0068855_100058075 3300005563 Bacteria 4532
24 Ga0068855_100114915 3300005563 Bacteria 3086
25 Ga0068855_100128162 3300005563 Bacteria 2900
26 Ga0068857_100198137 3300005577 Bacteria 1830
27 Ga0068859_100076622 3300005617 Bacteria 3385
28 Ga0068863_100264590 3300005841 Bacteria 1663
29 Ga0068863_100907981 3300005841 Bacteria 881
30 Ga0068860_100576972 3300005843 Unclassified 1129
31 Ga0081455_10062327 3300005937 Unclassified 3135
32 Ga0081540_1036833 3300005983 Bacteria 2602
33 Ga0075428_100020905 3300006844 Bacteria 7247
34 Ga0097620_100076621 3300006931 Bacteria 3385
35 Ga0105240_10039827 3300009093 Bacteria 6015
36 Ga0105240_10192345 3300009093 Bacteria 2398
37 Ga0111539_10016069 3300009094 Bacteria 9289
38 Ga0105238_10013795 3300009551 Bacteria 8167
39 Ga0105238_10053552 3300009551 Bacteria 4054
40 Ga0163162_10342014 3300013306 Unclassified 1629
41 Ga0207695_10009080 3300025913 Bacteria 12348
42 Ga0207695_10154176 3300025913 Unclassified 2233
43 Ga0207663_10008573 3300025916 Bacteria 5358
44 Ga0207662_10123613 3300025918 Bacteria 1625
45 Ga0207662_10289554 3300025918 Bacteria 1086
46 Ga0207694_10008878 3300025924 Bacteria 7584
47 Ga0207694_10036332 3300025924 Unclassified 3781
48 Ga0207659_10781516 3300025926 Unclassified 820
49 Ga0207664_10005226 3300025929 Bacteria 8855
50 Ga0207686_10156666 3300025934 Unclassified 1592
51 Ga0207670_10254816 3300025936 Bacteria 1358
52 Ga0207670_10360881 3300025936 Unclassified 1153
53 Ga0207670_11158606 3300025936 Unclassified 654
54 Ga0207667_10175510 3300025949 Bacteria 2202
55 Ga0207651_10113501 3300025960 Bacteria 2039
56 Ga0207668_10148486 3300025972 Bacteria 1812
57 Ga0207708_10206021 3300026075 Bacteria 1571
58 Ga0207641_10218290 3300026088 Bacteria 1767
59 Ga0207641_10593175 3300026088 Bacteria 1084
60 Ga0207674_10603459 3300026116 Unclassified 1060
61 Ga0265337_1000305 3300028556 Bacteria 26124
62 Ga0265337_1032472 3300028556 Bacteria 1544
63 Ga0265336_10001447 3300028666 Bacteria 10825
64 Ga0265336_10035863 3300028666 Bacteria 1528
65 Ga0265338_10003857 3300028800 Bacteria 20792
66 Ga0265338_10023484 3300028800 Bacteria 6338
67 Ga0265338_10025082 3300028800 Bacteria 6067
68 Ga0265338_10054198 3300028800 Bacteria 3579
69 Ga0265338_10064298 3300028800 Bacteria 3192
70 Ga0265338_10065340 3300028800 Bacteria 3157
71 Ga0265338_10095219 3300028800 Unclassified 2447
72 Ga0265338_10249029 3300028800 Bacteria 1312
73 Ga0265338_10380899 3300028800 Unclassified 1009
74 Ga0265324_10003414 3300029957 Bacteria 7583
75 Ga0265324_10136220 3300029957 Eukaryota 834
76 Ga0265328_10018797 3300031239 Bacteria 2661
77 Ga0265320_10009019 3300031240 Bacteria 6048
78 Ga0265327_10002102 3300031251 Bacteria 22166
79 Ga0265327_10064601 3300031251 Bacteria 1854
80 Ga0265327_10195382 3300031251 Unclassified 919
81 Ga0265313_10144271 3300031595 Bacteria 1022
82 Ga0265314_10000499 3300031711 Bacteria 50725
83 Ga0265314_10050404 3300031711 Bacteria 2908
84 Ga0265342_10158454 3300031712 Unclassified 1253
85 Ga0265342_10248018 3300031712 Unclassified 951
86 Ga0373924_0303462 3300035410 Bacteria 709
87 Ga0373927_0013832 3300035695 Bacteria 5357
88 Ga0373925_0104389 3300037068 Bacteria 2182
89 Ga0451577_0000911 3300042876 Bacteria 43516
90 Ga0453684_0002874 3300044712 Bacteria 40400
91 Ga0453684_1033926 3300044712 Unclassified 872
92 Ga0451576_0305925 3300045051 Bacteria 1663
93 Ga0451576_0631870 3300045051 Bacteria 1125
94 Ga0495592_0074120 3300046454 Bacteria 2473
95 Ga0495592_0314420 3300046454 Unclassified 1014
96 Ga0495662_0350038 3300046476 Bacteria 726
97 Ga0495628_0421775 3300046516 Bacteria 972
98 Ga0495630_0043159 3300046517 Bacteria 3368
99 Ga0495630_0379761 3300046517 Bacteria 1082
100 Ga0495586_0042663 3300046535 Bacteria 2442
101 Ga0495586_0466132 3300046535 Unclassified 728
102 Ga0495622_0011085 3300046557 Bacteria 4161
103 Ga0495634_0078081 3300046642 Bacteria 2170
104 Ga0495669_0173948 3300046684 Bacteria 1025
105 Ga0495613_0459501 3300046689 Unclassified 862
106 Ga0495604_0398522 3300047317 Bacteria 907
107 Ga0495636_0233634 3300047318 Unclassified 847
108 Ga0495675_0169676 3300047444 Bacteria 1341
109 Ga0501209_079271 3300049656 Unclassified 945
110 nmdc:mga06r32_547732_c1 3300050510 Bacteria 1131
111 nmdc:mga08y16_11263_c1 3300050511 Bacteria 9393
112 Ga0500650_0050209 3300053098 Bacteria 1937
113 Ga0265327_10215057
114 Ga0065704_10014339
115 Ga0065707_10641011
116 Ga0070658_10558987
117 Ga0070689_100007377
118 Ga0070689_100194869
119 Ga0070689_100307390
120 Ga0070687_100075643
121 Ga0070668_100219959
122 Ga0070675_100068161
123 Ga0070688_100015331
124 Ga0070714_100009418
125 Ga0070701_10013126
126 Ga0070694_100001632
127 Ga0070694_100485939
128 Ga0070685_10140070
129 Ga0070685_10271700
130 Ga0070685_10475846
131 Ga0070686_100014277
132 Ga0070695_100219982
133 Ga0070704_100405409
134 Ga0070704_100446802
135 Ga0068855_100058075
136 Ga0068855_100114915
137 Ga0068855_100128162
138 Ga0068857_100198137
139 Ga0068859_100076622
140 Ga0068863_100264590
141 Ga0068863_100907981
142 Ga0068860_100576972
143 Ga0081455_10062327
144 Ga0081540_1036833
145 Ga0075428_100020905
146 Ga0097620_100076621
147 Ga0105240_10039827
148 Ga0105240_10192345
149 Ga0111539_10016069
150 Ga0105238_10013795
151 Ga0105238_10053552
152 Ga0163162_10342014
153 Ga0207695_10009080
154 Ga0207695_10154176
155 Ga0207663_10008573
156 Ga0207662_10123613
157 Ga0207662_10289554
158 Ga0207694_10008878
159 Ga0207694_10036332
160 Ga0207659_10781516
161 Ga0207664_10005226
162 Ga0207686_10156666
163 Ga0207670_10254816
164 Ga0207670_10360881
165 Ga0207670_11158606
166 Ga0207667_10175510
167 Ga0207651_10113501
168 Ga0207668_10148486
169 Ga0207708_10206021
170 Ga0207641_10218290
171 Ga0207641_10593175
172 Ga0207674_10603459
173 Ga0265337_1000305
174 Ga0265337_1032472
175 Ga0265336_10001447
176 Ga0265336_10035863
177 Ga0265338_10003857
178 Ga0265338_10023484
179 Ga0265338_10025082
180 Ga0265338_10054198
181 Ga0265338_10064298
182 Ga0265338_10065340
183 Ga0265338_10095219
184 Ga0265338_10249029
185 Ga0265338_10380899
186 Ga0265324_10003414
187 Ga0265324_10136220
188 Ga0265328_10018797
189 Ga0265320_10009019
190 Ga0265327_10002102
191 Ga0265327_10064601
192 Ga0265327_10195382
193 Ga0265313_10144271
194 Ga0265314_10000499
195 Ga0265314_10050404
196 Ga0265342_10158454
197 Ga0265342_10248018
198 Ga0373924_0303462
199 Ga0373927_0013832
200 Ga0373925_0104389
201 Ga0451577_0000911
202 Ga0453684_0002874
203 Ga0453684_1033926
204 Ga0451576_0305925
205 Ga0451576_0631870
206 Ga0495592_0074120
207 Ga0495592_0314420
208 Ga0495662_0350038
209 Ga0495628_0421775
210 Ga0495630_0043159
211 Ga0495630_0379761
212 Ga0495586_0042663
213 Ga0495586_0466132
214 Ga0495622_0011085
215 Ga0495634_0078081
216 Ga0495669_0173948
217 Ga0495613_0459501
218 Ga0495604_0398522
219 Ga0495636_0233634
220 Ga0495675_0169676
221 Ga0501209_079271
222 nmdc:mga06r32_547732_c1
223 nmdc:mga08y16_11263_c1
224 Ga0500650_0050209

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

15

182

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9539 1 163
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9458 1 163
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9421 4 176
6caz-assembly1.cif.gz_A crystal structure of a peptide deformylase from legionella pneumophila 0.9395 1 180
6jf3-assembly1.cif.gz_B actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9388 1 163
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9539 1 163 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9236 1 163 3.90.45.10
af_K7VJY5_57_249_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9182 3 176 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.917 1 163 3.90.45.10
4dr9B00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9128 3 179 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A2E7QKR7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9891 1 174 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A3D5JYC1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9886 1 174 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7C3IKV4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9817 1 176 GO:0006412
GO:0042586
GO:0046872
AF-A0A6N6P2G3-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9806 1 176 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V6D107-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9783 1 176 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map