F064884

General Info

Members Datasets Scaffolds Average Seq Length
111 100 108 121

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10317394|Ga0307410_103173942
Length 137
Sequence VTKQNHQSSIFQSSIKVSEREEKFDLEERTYQFALAVRKLVKSHRWSTEQRTDVTQILRSSGSVAANYVEANNPISSADFSHRLRIARKEASESRLWLRLIGETSDDDRKATLRYLYREADALTRILTSILHKLGDR

Samples

Sample ID Description Type Environment
1 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
2 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
3 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
91 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
92 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
93 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
96 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
97 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
98 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
99 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
100 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.51
Nodule 0
Rhizoplane 0
Rhizosphere 77.48
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10089491 3300002077 Bacteria 565
2 rootH1_10125880 3300003316 Bacteria 5318
3 rootH1_10048961 3300003323 Bacteria 3637
4 rootH1_10134694 3300003323 Bacteria 4261
5 Ga0055536_1000006 3300003781 Bacteria 347733
6 Ga0055530_10004623 3300003791 Bacteria 7006
7 Ga0070658_10029533 3300005327 Bacteria 4405
8 Ga0070676_10037156 3300005328 Bacteria 2808
9 Ga0070661_100078440 3300005344 Bacteria 2436
10 Ga0070675_100405210 3300005354 Unclassified 1217
11 Ga0070675_101227430 3300005354 Unclassified 690
12 Ga0070708_100665209 3300005445 Bacteria 981
13 Ga0070663_100319378 3300005455 Bacteria 1248
14 Ga0070662_101108089 3300005457 Bacteria 679
15 Ga0068867_100000029 3300005459 Bacteria 87333
16 Ga0068867_100234050 3300005459 Bacteria 1486
17 Ga0070664_100731399 3300005564 Bacteria 923
18 Ga0068856_100019013 3300005614 Bacteria 6665
19 Ga0068860_100162281 3300005843 Bacteria 2155
20 Ga0068862_100209143 3300005844 Bacteria 1762
21 Ga0075363_100602513 3300006048 Unclassified 658
22 Ga0075362_10725943 3300006177 Unclassified 519
23 Ga0075366_10000135 3300006195 Bacteria 30916
24 Ga0097621_102291032 3300006237 Bacteria 517
25 Ga0105245_10179713 3300009098 Bacteria 2021
26 Ga0105243_10000381 3300009148 Bacteria 47569
27 Ga0105242_10413890 3300009176 Unclassified 1261
28 Ga0105237_10150657 3300009545 Bacteria 2322
29 Ga0157373_10029719 3300013100 Bacteria 3934
30 Ga0157370_10359770 3300013104 Bacteria 1341
31 Ga0157369_10000047 3300013105 Bacteria 172682
32 Ga0157374_10003138 3300013296 Bacteria 13890
33 Ga0157372_10312509 3300013307 Bacteria 1829
34 Ga0157377_10061524 3300014745 Bacteria 2146
35 Ga0157376_10070527 3300014969 Bacteria 2966
36 Ga0182006_1000287 3300015261 Bacteria 44409
37 Ga0183373_1002 3300015682 Bacteria 990153
38 Ga0213876_10336020 3300021384 Bacteria 803
39 Ga0209676_1000039 3300025292 Bacteria 443158
40 Ga0209050_1000033 3300025298 Bacteria 442615
41 Ga0207705_10014664 3300025909 Bacteria 5638
42 Ga0207671_10496065 3300025914 Bacteria 973
43 Ga0207687_10028132 3300025927 Bacteria 3776
44 Ga0207706_10859980 3300025933 Bacteria 768
45 Ga0207686_10189836 3300025934 Bacteria 1464
46 Ga0207709_10000508 3300025935 Bacteria 34267
47 Ga0207689_10105625 3300025942 Bacteria 2314
48 Ga0207677_10628426 3300026023 Unclassified 945
49 Ga0207702_10022509 3300026078 Bacteria 5224
50 Ga0207641_11420327 3300026088 Bacteria 695
51 Ga0207648_10000350 3300026089 Bacteria 50776
52 Ga0207648_10145721 3300026089 Bacteria 2089
53 Ga0268265_10140663 3300028380 Bacteria 2020
54 Ga0268264_11449662 3300028381 Unclassified 697
55 Ga0265334_10003785 3300028573 Bacteria 6838
56 Ga0265323_10000208 3300028653 Bacteria 34951
57 Ga0265323_10009828 3300028653 Bacteria 3892
58 Ga0265323_10028139 3300028653 Bacteria 2108
59 Ga0265323_10058252 3300028653 Bacteria 1349
60 Ga0265322_10003264 3300028654 Bacteria 4920
61 Ga0307515_10002441 3300028794 Bacteria 40493
62 Ga0307515_10004266 3300028794 Bacteria 29673
63 Ga0265338_10821810 3300028800 Bacteria 636
64 Ga0265324_10231806 3300029957 Unclassified 627
65 Ga0265330_10046640 3300031235 Bacteria 1909
66 Ga0265339_10547358 3300031249 Unclassified 532
67 Ga0265331_10006336 3300031250 Bacteria 7006
68 Ga0265327_10001142 3300031251 Bacteria 36261
69 Ga0265316_10015245 3300031344 Bacteria 6727
70 Ga0307408_101260394 3300031548 Unclassified 692
71 Ga0265342_10004398 3300031712 Bacteria 11115
72 Ga0307405_10000009 3300031731 Bacteria 259388
73 Ga0307410_10317394 3300031852 Bacteria 1235
74 Ga0307406_10070514 3300031901 Bacteria 2289
75 Ga0307407_10376521 3300031903 Bacteria 1012
76 Ga0307407_10545694 3300031903 Bacteria 856
77 Ga0307416_101007842 3300032002 Bacteria 936
78 Ga0307414_10023427 3300032004 Bacteria 3916
79 Ga0307414_10361046 3300032004 Bacteria 1250
80 Ga0307414_12155687 3300032004 Unclassified 520
81 Ga0436365_0715974 3300039437 Bacteria 832
82 Ga0451837_1165650 3300041494 Bacteria 840
83 Ga0451577_0000116 3300042876 Bacteria 174702
84 Ga0453684_0000412 3300044712 Bacteria 175080
85 Ga0495585_0333857 3300046492 Bacteria 739
86 Ga0495606_0503165 3300046507 Bacteria 611
87 Ga0495610_0003036 3300046512 Bacteria 13440
88 Ga0495631_0001037 3300046518 Bacteria 17230
89 Ga0495648_0173309 3300046524 Bacteria 1103
90 Ga0495652_0585403 3300046529 Bacteria 763
91 Ga0495587_0254150 3300046536 Unclassified 988
92 Ga0495633_0000015 3300046558 Bacteria 254484
93 Ga0495634_0054489 3300046642 Bacteria 2677
94 Ga0495625_0095014 3300046660 Bacteria 2056
95 Ga0495647_0567559 3300046681 Unclassified 531
96 Ga0495624_0678774 3300046690 Unclassified 612
97 Ga0495686_0003586 3300047472 Bacteria 13326
98 Ga0501223_011289 3300049663 Bacteria 1792
99 Ga0501227_032002 3300049665 Bacteria 1267
100 Ga0501259_029718 3300049688 Bacteria 1024
101 nmdc:mga03683_650641_c1 3300050489 Unclassified 519
102 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
103 Ga0500643_057910 3300053087 Bacteria 1093
104 Ga0500650_0067593 3300053098 Bacteria 1670
105 Ga0500608_023447 3300053122 Bacteria 2873
106 Ga0500618_000016 3300053125 Bacteria 164049
107 Ga0500624_000583 3300053157 Bacteria 10075
108 Ga0500627_0337541 3300053158 Unclassified 652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10029533 Ga0070658_100295332 103
2 3300005344 Ga0070661_100078440 Ga0070661_1000784402 103
3 3300005457 Ga0070662_101108089 Ga0070662_1011080892 103
4 3300005564 Ga0070664_100731399 Ga0070664_1007313992 103
5 3300025909 Ga0207705_10014664 Ga0207705_100146642 103
6 3300025933 Ga0207706_10859980 Ga0207706_108599802 103
7 3300013296 Ga0157374_10003138 Ga0157374_100031387 105
8 3300003316 rootH1_10125880 rootH1_101258802 110
9 3300042876 Ga0451577_0000116 Ga0451577_0000116_60507_60842 111
10 3300044712 Ga0453684_0000412 Ga0453684_0000412_60507_60842 111
11 iso_pu_bacteria 2842722452 2842727574 114
12 iso_pu_bacteria 2842909656 2842911219 114
13 iso_pu_bacteria 2902048731 2902049554 114
14 3300005459 Ga0068867_100234050 Ga0068867_1002340502 117
15 3300005844 Ga0068862_100209143 Ga0068862_1002091432 117
16 3300009545 Ga0105237_10150657 Ga0105237_101506572 117
17 3300026089 Ga0207648_10145721 Ga0207648_101457213 117
18 3300028380 Ga0268265_10140663 Ga0268265_101406634 117
19 3300003781 Ga0055536_1000006 Ga0055536_1000006217 118
20 3300003791 Ga0055530_10004623 Ga0055530_100046236 118
21 3300005843 Ga0068860_100162281 Ga0068860_1001622813 118
22 3300013100 Ga0157373_10029719 Ga0157373_100297192 118
23 3300013104 Ga0157370_10359770 Ga0157370_103597703 118
24 3300013105 Ga0157369_10000047 Ga0157369_1000004747 118
25 3300013307 Ga0157372_10312509 Ga0157372_103125092 118
26 3300015261 Ga0182006_1000287 Ga0182006_10002876 118
27 3300015682 Ga0183373_1002 Ga0183373_1002721 118
28 3300025292 Ga0209676_1000039 Ga0209676_1000039309 118
29 3300025298 Ga0209050_1000033 Ga0209050_1000033139 118
30 3300026088 Ga0207641_11420327 Ga0207641_114203271 118
31 3300028381 Ga0268264_11449662 Ga0268264_114496622 118
32 3300031731 Ga0307405_10000009 Ga0307405_10000009142 118
33 3300041494 Ga0451837_1165650 Ga0451837_1165650_120_476 118
34 3300046512 Ga0495610_0003036 Ga0495610_0003036_4791_5147 118
35 3300046642 Ga0495634_0054489 Ga0495634_0054489_1321_1710 118
36 3300005328 Ga0070676_10037156 Ga0070676_100371563 119
37 3300005354 Ga0070675_100405210 Ga0070675_1004052101 119
38 3300005445 Ga0070708_100665209 Ga0070708_1006652092 119
39 3300005459 Ga0068867_100000029 Ga0068867_10000002950 119
40 3300005614 Ga0068856_100019013 Ga0068856_1000190136 119
41 3300009098 Ga0105245_10179713 Ga0105245_101797132 119
42 3300009148 Ga0105243_10000381 Ga0105243_1000038110 119
43 3300009176 Ga0105242_10413890 Ga0105242_104138902 119
44 3300014745 Ga0157377_10061524 Ga0157377_100615242 119
45 3300014969 Ga0157376_10070527 Ga0157376_100705272 119
46 3300021384 Ga0213876_10336020 Ga0213876_103360201 119
47 3300025914 Ga0207671_10496065 Ga0207671_104960651 119
48 3300025927 Ga0207687_10028132 Ga0207687_100281323 119
49 3300025934 Ga0207686_10189836 Ga0207686_101898362 119
50 3300025935 Ga0207709_10000508 Ga0207709_1000050822 119
51 3300025942 Ga0207689_10105625 Ga0207689_101056253 119
52 3300026023 Ga0207677_10628426 Ga0207677_106284262 119
53 3300026078 Ga0207702_10022509 Ga0207702_100225092 119
54 3300026089 Ga0207648_10000350 Ga0207648_1000035025 119
55 3300039437 Ga0436365_0715974 Ga0436365_0715974_451_810 119
56 3300046492 Ga0495585_0333857 Ga0495585_0333857_107_475 119
57 3300046507 Ga0495606_0503165 Ga0495606_0503165_106_477 119
58 3300046518 Ga0495631_0001037 Ga0495631_0001037_15853_16221 119
59 3300046524 Ga0495648_0173309 Ga0495648_0173309_567_938 119
60 3300046536 Ga0495587_0254150 Ga0495587_0254150_88_456 119
61 3300046681 Ga0495647_0567559 Ga0495647_0567559_84_479 119
62 3300046690 Ga0495624_0678774 Ga0495624_0678774_194_589 119
63 3300047472 Ga0495686_0003586 Ga0495686_0003586_10345_10716 119
64 3300053098 Ga0500650_0067593 Ga0500650_0067593_758_1126 119
65 3300053157 Ga0500624_000583 Ga0500624_000583_6526_6897 119
66 3300003323 rootH1_10048961 rootH1_100489612 120
67 3300006177 Ga0075362_10725943 Ga0075362_107259432 120
68 3300006195 Ga0075366_10000135 Ga0075366_1000013526 120
69 3300028653 Ga0265323_10000208 Ga0265323_1000020821 120
70 3300028653 Ga0265323_10009828 Ga0265323_100098283 120
71 3300028653 Ga0265323_10028139 Ga0265323_100281392 120
72 3300028654 Ga0265322_10003264 Ga0265322_100032643 120
73 3300028794 Ga0307515_10002441 Ga0307515_100024412 120
74 3300028794 Ga0307515_10004266 Ga0307515_100042662 120
75 3300031235 Ga0265330_10046640 Ga0265330_100466402 120
76 3300031249 Ga0265339_10547358 Ga0265339_105473581 120
77 3300031344 Ga0265316_10015245 Ga0265316_100152453 120
78 3300031548 Ga0307408_101260394 Ga0307408_1012603942 120
79 3300031712 Ga0265342_10004398 Ga0265342_100043987 120
80 3300032004 Ga0307414_10023427 Ga0307414_100234272 120
81 3300032004 Ga0307414_12155687 Ga0307414_121556871 120
82 3300046529 Ga0495652_0585403 Ga0495652_0585403_237_611 120
83 3300046558 Ga0495633_0000015 Ga0495633_0000015_108501_108875 120
84 3300046660 Ga0495625_0095014 Ga0495625_0095014_453_830 120
85 3300049663 Ga0501223_011289 Ga0501223_011289_282_656 120
86 3300049688 Ga0501259_029718 Ga0501259_029718_512_886 120
87 3300050489 nmdc:mga03683_650641_c1 nmdc:mga03683_650641_c1_31_402 120
88 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_43670_44044 120
89 3300053122 Ga0500608_023447 Ga0500608_023447_770_1147 120
90 3300053125 Ga0500618_000016 Ga0500618_000016_21583_21957 120
91 3300005354 Ga0070675_101227430 Ga0070675_1012274301 121
92 3300006237 Ga0097621_102291032 Ga0097621_1022910321 121
93 3300028573 Ga0265334_10003785 Ga0265334_100037855 121
94 3300028653 Ga0265323_10058252 Ga0265323_100582522 121
95 3300028800 Ga0265338_10821810 Ga0265338_108218101 121
96 3300029957 Ga0265324_10231806 Ga0265324_102318061 121
97 3300031250 Ga0265331_10006336 Ga0265331_100063365 121
98 3300031251 Ga0265327_10001142 Ga0265327_1000114210 121
99 3300031852 Ga0307410_10317394 Ga0307410_103173942 121
100 3300031903 Ga0307407_10376521 Ga0307407_103765212 121
101 3300053087 Ga0500643_057910 Ga0500643_057910_316_681 121
102 3300053158 Ga0500627_0337541 Ga0500627_0337541_88_453 121
103 3300002077 JGI24744J21845_10089491 JGI24744J21845_100894911 122
104 3300003323 rootH1_10134694 rootH1_101346943 122
105 3300005455 Ga0070663_100319378 Ga0070663_1003193782 122
106 3300006048 Ga0075363_100602513 Ga0075363_1006025132 122
107 3300031901 Ga0307406_10070514 Ga0307406_100705143 122
108 3300031903 Ga0307407_10545694 Ga0307407_105456942 122
109 3300032002 Ga0307416_101007842 Ga0307416_1010078422 122
110 3300032004 Ga0307414_10361046 Ga0307414_103610462 122
111 3300049665 Ga0501227_032002 Ga0501227_032002_181_555 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

22

129

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s8t-assembly1.cif.gz_J m. xanthus ferritin-like protein encc 0.9869 65 116
7s5k-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.9868 65 117
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.985 65 117
7s5c-assembly1.cif.gz_I m. xanthus ferritin-like protein encb 0.9827 65 117
7s5k-assembly1.cif.gz_E m. xanthus ferritin-like protein encb 0.9824 65 117
ID Description Score Start End Superfamily
5n5fH00 Special;Helix non-globular;Helix Hairpins; 0.9863 66 118 6.10.140.1960
4r42B01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9792 65 118 1.20.1260.10
4l0rA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.973 61 121 1.20.58.90
5l8gV00 Special;Helix non-globular;Helix Hairpins; 0.9695 66 118 6.10.140.1960
5l89X00 Special;Helix non-globular;Helix Hairpins; 0.9694 66 119 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A2M7VBE4-F1-model_v4 Four helix bundle protein 0.9795 7 122
AF-A0A2M7XMJ7-F1-model_v4 Four helix bundle protein 0.9754 7 119
AF-A0A3E0E4P2-F1-model_v4 deleted 0.9754 10 120
AF-A0A1G2I4S0-F1-model_v4 Four helix bundle protein 0.9751 7 122
AF-A0A2E2NZZ6-F1-model_v4 Four helix bundle protein 0.9751 9 118

Feature Viewer

pLDDT pTM Quality
94.17 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map