F064239

General Info

Members Datasets Scaffolds Average Seq Length
111 94 111 118

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10016243|Ga0157379_100162437
Length 124
Sequence VAYAQLVARPKWKLTVRNGSDVEHASFGELGEAVGAMRARAFEIRAEGPAEPTSVLRDFKPGDQVQARLQLSGKGLLHKPIAGIDVRGDGTFMPYRGGMRREELDPTKHETPFDLVRETLESDG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
65 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
68 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
69 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
90 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
91 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
92 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
93 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
94 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 19.82
Rhizosphere 76.58
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1027312 3300000546 Unclassified 611
2 JGI24740J21852_10001346 3300001979 Bacteria 11191
3 Ga0070683_100001122 3300005329 Bacteria 20234
4 Ga0070691_10000011 3300005341 Bacteria 57498
5 Ga0070661_100000045 3300005344 Bacteria 94702
6 Ga0070688_100000076 3300005365 Bacteria 49151
7 Ga0070667_101128860 3300005367 Bacteria 733
8 Ga0070685_10000062 3300005466 Bacteria 62782
9 Ga0070684_100044311 3300005535 Bacteria 3848
10 Ga0070684_100439498 3300005535 Unclassified 1205
11 Ga0070684_100720415 3300005535 Bacteria 931
12 Ga0070664_100132061 3300005564 Bacteria 2194
13 Ga0068863_100075702 3300005841 Bacteria 3185
14 Ga0068858_100000086 3300005842 Bacteria 96201
15 Ga0068858_100455275 3300005842 Bacteria 1233
16 Ga0068860_100501464 3300005843 Bacteria 1212
17 Ga0081540_1000126 3300005983 Bacteria 81203
18 Ga0075430_100090051 3300006846 Bacteria 2567
19 Ga0068865_100447691 3300006881 Bacteria 1067
20 Ga0105240_11102247 3300009093 Unclassified 845
21 Ga0105240_12478216 3300009093 Bacteria 536
22 Ga0105245_10000291 3300009098 Bacteria 47913
23 Ga0105245_10006435 3300009098 Bacteria 10339
24 Ga0105247_10119798 3300009101 Bacteria 1704
25 Ga0105243_10005886 3300009148 Bacteria 9497
26 Ga0105242_10000415 3300009176 Bacteria 33960
27 Ga0105242_10000927 3300009176 Bacteria 22792
28 Ga0105249_10000085 3300009553 Bacteria 133497
29 Ga0157370_10310411 3300013104 Bacteria 1455
30 Ga0157374_10108666 3300013296 Bacteria 2666
31 Ga0157380_10000247 3300014326 Bacteria 32527
32 Ga0157379_10016243 3300014968 Bacteria 6551
33 Ga0157376_10026764 3300014969 Bacteria 4562
34 Ga0206353_11019719 3300020082 Bacteria 667
35 Ga0207649_10000021 3300025920 Bacteria 209660
36 Ga0207694_10000035 3300025924 Bacteria 195870
37 Ga0207650_10211144 3300025925 Bacteria 1559
38 Ga0207687_10003696 3300025927 Bacteria 10298
39 Ga0207686_10000016 3300025934 Bacteria 198779
40 Ga0207686_10000157 3300025934 Bacteria 51500
41 Ga0207704_10330358 3300025938 Bacteria 1180
42 Ga0207679_10021319 3300025945 Bacteria 4392
43 Ga0207712_10000033 3300025961 Bacteria 209336
44 Ga0207668_10059005 3300025972 Bacteria 2686
45 Ga0207668_10093802 3300025972 Bacteria 2212
46 Ga0207640_10000865 3300025981 Bacteria 17185
47 Ga0207658_10964296 3300025986 Bacteria 777
48 Ga0207703_10000072 3300026035 Bacteria 120727
49 Ga0207639_10261440 3300026041 Bacteria 1514
50 Ga0207641_10003532 3300026088 Bacteria 13839
51 Ga0207641_10012739 3300026088 Bacteria 6895
52 Ga0207676_10000197 3300026095 Bacteria 52737
53 Ga0268264_10254880 3300028381 Bacteria 1632
54 Ga0265319_1000029 3300028563 Bacteria 131291
55 Ga0265336_10087669 3300028666 Unclassified 928
56 Ga0265338_10002829 3300028800 Bacteria 25326
57 Ga0265324_10066356 3300029957 Unclassified 1231
58 Ga0265325_10025513 3300031241 Unclassified 3208
59 Ga0265331_10028666 3300031250 Unclassified 2783
60 Ga0265313_10083175 3300031595 Unclassified 1450
61 Ga0265342_10162507 3300031712 Unclassified 1234
62 Ga0451807_0660772 3300041486 Bacteria 1466
63 Ga0466963_0003753 3300044694 Bacteria 8746
64 Ga0466958_0080621 3300045836 Bacteria 2002
65 Ga0466967_0000072 3300045976 Bacteria 37332
66 Ga0466967_0208463 3300045976 Bacteria 1853
67 Ga0495629_0004158 3300046459 Bacteria 10865
68 Ga0495610_0054392 3300046512 Bacteria 1934
69 Ga0495620_0000644 3300046515 Bacteria 21728
70 Ga0495630_0524383 3300046517 Bacteria 908
71 Ga0495637_0112695 3300046520 Bacteria 1053
72 Ga0495599_0047311 3300046678 Bacteria 2696
73 Ga0495613_0133512 3300046689 Bacteria 1777
74 Ga0495670_0054108 3300046691 Bacteria 2010
75 Ga0495600_0027861 3300046809 Bacteria 3653
76 Ga0495674_0014373 3300047319 Bacteria 7411
77 Ga0495676_0135523 3300047321 Bacteria 1771
78 Ga0495675_0071842 3300047444 Bacteria 2184
79 Ga0495602_0735512 3300048088 Bacteria 667
80 Ga0496100_0000003 3300048903 Bacteria 360802
81 Ga0496101_0000003 3300048904 Bacteria 406565
82 Ga0496102_0000061 3300048905 Bacteria 167066
83 Ga0496102_0555152 3300048905 Bacteria 1071
84 Ga0496102_1415179 3300048905 Bacteria 614
85 Ga0496103_0000044 3300048906 Bacteria 167066
86 Ga0496103_0025152 3300048906 Bacteria 3597
87 Ga0496103_0670789 3300048906 Bacteria 658
88 Ga0496104_0000007 3300048907 Bacteria 524804
89 Ga0496104_0000066 3300048907 Bacteria 108721
90 Ga0496105_0000002 3300048908 Bacteria 753215
91 Ga0496105_0000020 3300048908 Bacteria 181484
92 Ga0496106_0000015 3300048909 Bacteria 187570
93 Ga0496107_0000008 3300048910 Bacteria 251874
94 Ga0496108_0000032 3300048911 Bacteria 158930
95 Ga0496109_0000217 3300048912 Bacteria 56358
96 Ga0496110_0000003 3300048913 Bacteria 144124
97 Ga0496111_0000058 3300048914 Bacteria 44867
98 Ga0496112_0056995 3300048915 Bacteria 3846
99 Ga0496113_0000019 3300048916 Bacteria 72625
100 Ga0496114_0161405 3300048917 Bacteria 1949
101 Ga0496119_0017349 3300048922 Bacteria 5418
102 Ga0496120_0176778 3300048923 Unclassified 1051
103 Ga0501076_0549349 3300049592 Unclassified 952
104 nmdc:mga0qj67_60816_c1 3300050509 Bacteria 2998
105 Ga0495601_0207549 3300053077 Bacteria 1280
106 Ga0495612_0000978 3300053078 Bacteria 11760
107 Ga0495612_0572084 3300053078 Bacteria 521
108 Ga0495655_0000003 3300053083 Bacteria 303053
109 Ga0495619_0000103 3300053085 Bacteria 64239
110 Ga0500566_0004587 3300053094 Bacteria 8234
111 Ga0500628_000002 3300053129 Bacteria 357687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100090051 Ga0075430_1000900514 101
2 3300013104 Ga0157370_10310411 Ga0157370_103104113 104
3 3300045836 Ga0466958_0080621 Ga0466958_0080621_1631_1945 104
4 3300048088 Ga0495602_0735512 Ga0495602_0735512_23_337 104
5 3300014326 Ga0157380_10000247 Ga0157380_100002473 106
6 3300046809 Ga0495600_0027861 Ga0495600_0027861_3183_3524 106
7 3300005842 Ga0068858_100000086 Ga0068858_10000008685 107
8 3300026035 Ga0207703_10000072 Ga0207703_1000007211 107
9 3300005329 Ga0070683_100001122 Ga0070683_10000112220 108
10 3300005535 Ga0070684_100044311 Ga0070684_1000443112 108
11 3300026095 Ga0207676_10000197 Ga0207676_1000019710 108
12 3300009098 Ga0105245_10000291 Ga0105245_1000029152 109
13 3300009553 Ga0105249_10000085 Ga0105249_1000008593 109
14 3300014968 Ga0157379_10016243 Ga0157379_100162437 109
15 3300014969 Ga0157376_10026764 Ga0157376_100267643 109
16 3300025961 Ga0207712_10000033 Ga0207712_10000033101 109
17 3300028563 Ga0265319_1000029 Ga0265319_1000029103 109
18 3300028666 Ga0265336_10087669 Ga0265336_100876691 109
19 3300028800 Ga0265338_10002829 Ga0265338_100028295 109
20 3300029957 Ga0265324_10066356 Ga0265324_100663562 109
21 3300031241 Ga0265325_10025513 Ga0265325_100255133 109
22 3300031250 Ga0265331_10028666 Ga0265331_100286663 109
23 3300031595 Ga0265313_10083175 Ga0265313_100831753 109
24 3300031712 Ga0265342_10162507 Ga0265342_101625072 109
25 3300044694 Ga0466963_0003753 Ga0466963_0003753_5879_6214 109
26 3300046515 Ga0495620_0000644 Ga0495620_0000644_12393_12743 109
27 3300046520 Ga0495637_0112695 Ga0495637_0112695_568_918 109
28 3300048903 Ga0496100_0000003 Ga0496100_0000003_111602_111937 109
29 3300048904 Ga0496101_0000003 Ga0496101_0000003_111602_111937 109
30 3300048905 Ga0496102_1415179 Ga0496102_1415179_80_436 109
31 3300048906 Ga0496103_0670789 Ga0496103_0670789_120_476 109
32 3300048907 Ga0496104_0000007 Ga0496104_0000007_159234_159590 109
33 3300048907 Ga0496104_0000066 Ga0496104_0000066_105718_106074 109
34 3300048908 Ga0496105_0000002 Ga0496105_0000002_362173_362529 109
35 3300048908 Ga0496105_0000020 Ga0496105_0000020_75411_75767 109
36 3300048909 Ga0496106_0000015 Ga0496106_0000015_150640_150975 109
37 3300048910 Ga0496107_0000008 Ga0496107_0000008_2662_2997 109
38 3300048911 Ga0496108_0000032 Ga0496108_0000032_22148_22522 109
39 3300048912 Ga0496109_0000217 Ga0496109_0000217_27647_28021 109
40 3300048922 Ga0496119_0017349 Ga0496119_0017349_4591_4947 109
41 3300048923 Ga0496120_0176778 Ga0496120_0176778_487_843 109
42 3300000546 LJNas_1027312 LJNas_10273121 110
43 3300001979 JGI24740J21852_10001346 JGI24740J21852_100013469 110
44 3300005341 Ga0070691_10000011 Ga0070691_100000119 110
45 3300005344 Ga0070661_100000045 Ga0070661_10000004556 110
46 3300005365 Ga0070688_100000076 Ga0070688_10000007643 110
47 3300005367 Ga0070667_101128860 Ga0070667_1011288602 110
48 3300005466 Ga0070685_10000062 Ga0070685_1000006243 110
49 3300005535 Ga0070684_100439498 Ga0070684_1004394982 110
50 3300005535 Ga0070684_100720415 Ga0070684_1007204151 110
51 3300005564 Ga0070664_100132061 Ga0070664_1001320613 110
52 3300005841 Ga0068863_100075702 Ga0068863_1000757022 110
53 3300005842 Ga0068858_100455275 Ga0068858_1004552752 110
54 3300005843 Ga0068860_100501464 Ga0068860_1005014643 110
55 3300005983 Ga0081540_1000126 Ga0081540_100012623 110
56 3300006881 Ga0068865_100447691 Ga0068865_1004476912 110
57 3300009093 Ga0105240_11102247 Ga0105240_111022473 110
58 3300009093 Ga0105240_12478216 Ga0105240_124782162 110
59 3300009098 Ga0105245_10006435 Ga0105245_100064353 110
60 3300009101 Ga0105247_10119798 Ga0105247_101197983 110
61 3300009148 Ga0105243_10005886 Ga0105243_100058868 110
62 3300009176 Ga0105242_10000415 Ga0105242_1000041510 110
63 3300009176 Ga0105242_10000927 Ga0105242_1000092717 110
64 3300013296 Ga0157374_10108666 Ga0157374_101086662 110
65 3300020082 Ga0206353_11019719 Ga0206353_110197192 110
66 3300025920 Ga0207649_10000021 Ga0207649_1000002135 110
67 3300025924 Ga0207694_10000035 Ga0207694_1000003597 110
68 3300025925 Ga0207650_10211144 Ga0207650_102111443 110
69 3300025927 Ga0207687_10003696 Ga0207687_100036968 110
70 3300025934 Ga0207686_10000016 Ga0207686_10000016173 110
71 3300025934 Ga0207686_10000157 Ga0207686_1000015738 110
72 3300025938 Ga0207704_10330358 Ga0207704_103303583 110
73 3300025945 Ga0207679_10021319 Ga0207679_100213195 110
74 3300025972 Ga0207668_10059005 Ga0207668_100590054 110
75 3300025972 Ga0207668_10093802 Ga0207668_100938023 110
76 3300025981 Ga0207640_10000865 Ga0207640_1000086510 110
77 3300025986 Ga0207658_10964296 Ga0207658_109642962 110
78 3300026041 Ga0207639_10261440 Ga0207639_102614402 110
79 3300026088 Ga0207641_10003532 Ga0207641_100035324 110
80 3300026088 Ga0207641_10012739 Ga0207641_100127396 110
81 3300028381 Ga0268264_10254880 Ga0268264_102548802 110
82 3300041486 Ga0451807_0660772 Ga0451807_0660772_890_1243 110
83 3300045976 Ga0466967_0000072 Ga0466967_0000072_25290_25628 110
84 3300045976 Ga0466967_0208463 Ga0466967_0208463_909_1247 110
85 3300046459 Ga0495629_0004158 Ga0495629_0004158_9513_9872 110
86 3300046512 Ga0495610_0054392 Ga0495610_0054392_385_723 110
87 3300046517 Ga0495630_0524383 Ga0495630_0524383_139_498 110
88 3300046678 Ga0495599_0047311 Ga0495599_0047311_213_575 110
89 3300046689 Ga0495613_0133512 Ga0495613_0133512_596_955 110
90 3300046691 Ga0495670_0054108 Ga0495670_0054108_329_685 110
91 3300047319 Ga0495674_0014373 Ga0495674_0014373_1865_2224 110
92 3300047321 Ga0495676_0135523 Ga0495676_0135523_799_1158 110
93 3300047444 Ga0495675_0071842 Ga0495675_0071842_1213_1665 110
94 3300048905 Ga0496102_0000061 Ga0496102_0000061_89602_89961 110
95 3300048905 Ga0496102_0555152 Ga0496102_0555152_240_599 110
96 3300048906 Ga0496103_0000044 Ga0496103_0000044_89602_89961 110
97 3300048906 Ga0496103_0025152 Ga0496103_0025152_2556_2915 110
98 3300048913 Ga0496110_0000003 Ga0496110_0000003_93780_94118 110
99 3300048914 Ga0496111_0000058 Ga0496111_0000058_31389_31727 110
100 3300048915 Ga0496112_0056995 Ga0496112_0056995_89_436 110
101 3300048916 Ga0496113_0000019 Ga0496113_0000019_2294_2641 110
102 3300048917 Ga0496114_0161405 Ga0496114_0161405_1180_1533 110
103 3300049592 Ga0501076_0549349 Ga0501076_0549349_113_445 110
104 3300050509 nmdc:mga0qj67_60816_c1 nmdc:mga0qj67_60816_c1_1868_2206 110
105 3300053077 Ga0495601_0207549 Ga0495601_0207549_867_1226 110
106 3300053078 Ga0495612_0000978 Ga0495612_0000978_6506_6859 110
107 3300053078 Ga0495612_0572084 Ga0495612_0572084_15_368 110
108 3300053083 Ga0495655_0000003 Ga0495655_0000003_274747_275106 110
109 3300053085 Ga0495619_0000103 Ga0495619_0000103_28982_29320 110
110 3300053094 Ga0500566_0004587 Ga0500566_0004587_716_1075 110
111 3300053129 Ga0500628_000002 Ga0500628_000002_274747_275106 110

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4u-assembly1.cif.gz_X crystal structure analysis of the beta-propeller protein ski8p 0.7245 50 90
4buj-assembly2.cif.gz_G crystal structure of the s. cerevisiae ski2-3-8 complex 0.6956 50 90
5mc6-assembly1.cif.gz_k cryo-em structure of a native ribosome-ski2-ski3-ski8 complex from s. cerevisiae 0.6956 50 90
4buj-assembly2.cif.gz_H crystal structure of the s. cerevisiae ski2-3-8 complex 0.69 53 90
8qcb-assembly1.cif.gz_C cryoem structure of a s. cerevisiae ski2387 complex in the open state 0.6797 50 90
ID Description Score Start End Superfamily
af_A0A1D8PQM4_197_370_3.90.1110.10 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.6997 53 89 3.90.1110.10
af_Q53PX8_66_295_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6831 65 88 2.130.10.10
af_A0A0R0FIS1_7_302_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6741 50 90 2.130.10.10
4jn8A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6659 49 81 3.30.390.10
5h47A00 Mainly Beta;6 Propeller;Neuraminidase;Fucose-specific lectin 0.6317 52 90 2.120.10.70
ID Description Score Start End GO Terms
AF-A0A537YTS5-F1-model_v4 Uncharacterized protein 0.962 20 110
AF-A0A838UZQ6-F1-model_v4 Uncharacterized protein 0.9446 12 110
AF-A0A640YAE4-F1-model_v4 Uncharacterized protein 0.9431 12 108
AF-A0A537YTS5-F1-model_v4 Uncharacterized protein 0.9418 20 110
AF-A0A7V8VIZ2-F1-model_v4 Uncharacterized protein 0.9174 14 110

Feature Viewer

pLDDT pTM Quality
83.8 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map