F060456

General Info

Members Datasets Scaffolds Average Seq Length
110 77 110 225

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0363458|Ga0451576_0363458_623_1411
Length 262
Sequence MRYFQPLYKYSVISQGNVRIYIHSRTFFEKESAAKKVAKMRILIIEDEYKIANSIKRGLEQENFMVDVAYEGEDGYDKASTDEYDVIILDLMLPKMDGLTICKNLRGEKIHTPILMLTAKGELEDKVNGLNAGADDYLPKPFAFVELLARVRALTRRPKKTNGTILSVDDLTLDPYAFEVKRGKKSIPLSKREFALLEYLMRHQGKIVSKDEIISHVWSYDAEILPNTVEVYIGYLRQKVDKNAGNKKTLIRTIRGFGYKIG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
69 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
74 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
75 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 0
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000717 3300005327 Bacteria 28715
2 Ga0070658_10021326 3300005327 Bacteria 5192
3 Ga0070658_10037592 3300005327 Bacteria 3903
4 Ga0070683_100000140 3300005329 Bacteria 46747
5 Ga0070690_100023763 3300005330 Bacteria 3763
6 Ga0070666_10170873 3300005335 Bacteria 1522
7 Ga0070680_100007242 3300005336 Bacteria 8457
8 Ga0070660_100000035 3300005339 Bacteria 77932
9 Ga0070660_100000837 3300005339 Bacteria 20454
10 Ga0070689_100305802 3300005340 Bacteria 1324
11 Ga0070708_100162564 3300005445 Bacteria 2081
12 Ga0070681_10507558 3300005458 Bacteria 1119
13 Ga0070679_100006394 3300005530 Bacteria 10972
14 Ga0070684_100000544 3300005535 Bacteria 25908
15 Ga0070684_100011428 3300005535 Bacteria 7076
16 Ga0070686_100001746 3300005544 Bacteria 12170
17 Ga0068855_100045161 3300005563 Bacteria 5211
18 Ga0068855_100160173 3300005563 Bacteria 2555
19 Ga0068855_100226471 3300005563 Unclassified 2095
20 Ga0068855_100846834 3300005563 Bacteria 969
21 Ga0068857_100034322 3300005577 Bacteria 4487
22 Ga0068857_100049490 3300005577 Bacteria 3728
23 Ga0068856_100104668 3300005614 Bacteria 2824
24 Ga0068856_100176276 3300005614 Unclassified 2150
25 Ga0068858_100260795 3300005842 Bacteria 1647
26 Ga0068860_100069576 3300005843 Bacteria 3345
27 Ga0068860_100261076 3300005843 Unclassified 1688
28 Ga0075369_10022314 3300006186 Bacteria 2610
29 Ga0075433_10165502 3300006852 Bacteria 1968
30 Ga0097620_101117827 3300006931 Bacteria 867
31 Ga0105240_10029625 3300009093 Bacteria 7126
32 Ga0105237_10491236 3300009545 Bacteria 1234
33 Ga0157374_10426095 3300013296 Bacteria 1326
34 Ga0157372_10005893 3300013307 Bacteria 13044
35 Ga0157372_10018029 3300013307 Bacteria 7589
36 Ga0163163_10040647 3300014325 Bacteria 4542
37 Ga0207705_10000280 3300025909 Bacteria 48562
38 Ga0207705_10027712 3300025909 Bacteria 4041
39 Ga0207695_10042601 3300025913 Bacteria 4845
40 Ga0207660_10001981 3300025917 Bacteria 13653
41 Ga0207657_10002071 3300025919 Bacteria 21703
42 Ga0207657_10002660 3300025919 Bacteria 19285
43 Ga0207652_10000657 3300025921 Bacteria 34000
44 Ga0207650_10025802 3300025925 Bacteria 4188
45 Ga0207661_10000021 3300025944 Bacteria 205381
46 Ga0207667_10048179 3300025949 Bacteria 4507
47 Ga0207667_10130557 3300025949 Bacteria 2588
48 Ga0207667_10136379 3300025949 Bacteria 2527
49 Ga0207702_10000001 3300026078 Bacteria 895738
50 Ga0207702_10075452 3300026078 Bacteria 2913
51 Ga0207702_10101113 3300026078 Bacteria 2545
52 Ga0207702_10141296 3300026078 Unclassified 2179
53 Ga0207702_10255264 3300026078 Bacteria 1648
54 Ga0207674_10664072 3300026116 Bacteria 1007
55 Ga0268264_10040067 3300028381 Bacteria 3871
56 Ga0265337_1002818 3300028556 Bacteria 7776
57 Ga0265337_1003164 3300028556 Bacteria 7229
58 Ga0265326_10004394 3300028558 Bacteria 4521
59 Ga0265334_10014732 3300028573 Bacteria 3255
60 Ga0265318_10042012 3300028577 Bacteria 1736
61 Ga0265322_10012103 3300028654 Bacteria 2495
62 Ga0265336_10005752 3300028666 Bacteria 4538
63 Ga0265338_10001381 3300028800 Bacteria 39481
64 Ga0265338_10002488 3300028800 Bacteria 27499
65 Ga0265338_10013628 3300028800 Bacteria 9153
66 Ga0265338_10017314 3300028800 Bacteria 7776
67 Ga0265339_10026410 3300031249 Bacteria 3326
68 Ga0265327_10025447 3300031251 Bacteria 3450
69 Ga0265316_10213759 3300031344 Bacteria 1425
70 Ga0307516_10000021 3300031730 Bacteria 192678
71 Ga0373959_0000001 3300034820 Bacteria 189143
72 Ga0395900_0362647 3300037418 Bacteria 1420
73 Ga0451577_0016369 3300042876 Bacteria 6870
74 Ga0451577_0303902 3300042876 Unclassified 1445
75 Ga0453683_0412512 3300044673 Bacteria 871
76 Ga0453684_0000652 3300044712 Bacteria 125090
77 Ga0453684_0000667 3300044712 Bacteria 122907
78 Ga0453684_0105334 3300044712 Bacteria 3440
79 Ga0453684_0157857 3300044712 Bacteria 2687
80 Ga0453684_0209124 3300044712 Unclassified 2269
81 Ga0453684_0698781 3300044712 Bacteria 1102
82 Ga0451576_0087355 3300045051 Bacteria 3243
83 Ga0451576_0092004 3300045051 Bacteria 3155
84 Ga0451576_0179174 3300045051 Bacteria 2213
85 Ga0451576_0363458 3300045051 Bacteria 1516
86 Ga0495583_0063370 3300046506 Bacteria 1643
87 Ga0501031_0000276 3300049568 Bacteria 29045
88 Ga0501032_0006237 3300049569 Bacteria 8775
89 Ga0501034_0019372 3300049571 Bacteria 6960
90 Ga0501034_0021503 3300049571 Bacteria 6574
91 Ga0501036_0017950 3300049572 Bacteria 5924
92 Ga0501037_0000113 3300049573 Bacteria 75610
93 Ga0501038_0010102 3300049574 Bacteria 8640
94 Ga0501039_0340196 3300049575 Bacteria 1179
95 Ga0501040_0313765 3300049576 Bacteria 1121
96 Ga0501042_0046477 3300049578 Bacteria 3095
97 Ga0501043_0000205 3300049579 Bacteria 54247
98 Ga0501046_0000038 3300049580 Bacteria 159193
99 Ga0501047_0000355 3300049581 Bacteria 51922
100 Ga0501048_0006697 3300049582 Bacteria 8751
101 Ga0501069_0317035 3300049585 Bacteria 916
102 Ga0501070_0037860 3300049586 Bacteria 4025
103 Ga0501080_0393587 3300049742 Bacteria 1247
104 Ga0501035_0000768 3300049822 Bacteria 34474
105 Ga0501044_0008259 3300049823 Bacteria 11415
106 nmdc:mga03683_153566_c1 3300050489 Bacteria 1040
107 nmdc:mga0yw44_206005_c1 3300050492 Bacteria 1300
108 nmdc:mga0sz30_13289_c1 3300050516 Bacteria 3221
109 Ga0500568_0088071 3300053139 Bacteria 1173
110 Ga0500570_000006 3300053724 Bacteria 129824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100846834 Ga0068855_1008468341 208
2 3300005563 Ga0068855_100160173 Ga0068855_1001601732 215
3 3300005614 Ga0068856_100104668 Ga0068856_1001046682 215
4 3300009545 Ga0105237_10491236 Ga0105237_104912362 215
5 3300025949 Ga0207667_10130557 Ga0207667_101305572 215
6 3300026078 Ga0207702_10075452 Ga0207702_100754523 215
7 3300042876 Ga0451577_0016369 Ga0451577_0016369_2570_3253 217
8 3300044712 Ga0453684_0209124 Ga0453684_0209124_1114_1767 217
9 3300042876 Ga0451577_0303902 Ga0451577_0303902_182_841 218
10 3300044712 Ga0453684_0000652 Ga0453684_0000652_107066_107725 218
11 3300044712 Ga0453684_0698781 Ga0453684_0698781_115_771 218
12 3300045051 Ga0451576_0087355 Ga0451576_0087355_264_941 218
13 3300005577 Ga0068857_100034322 Ga0068857_1000343221 219
14 3300025913 Ga0207695_10042601 Ga0207695_100426014 220
15 3300025909 Ga0207705_10027712 Ga0207705_100277123 221
16 3300025919 Ga0207657_10002660 Ga0207657_1000266012 221
17 3300005842 Ga0068858_100260795 Ga0068858_1002607952 222
18 3300005843 Ga0068860_100069576 Ga0068860_1000695762 222
19 3300006852 Ga0075433_10165502 Ga0075433_101655022 222
20 3300014325 Ga0163163_10040647 Ga0163163_100406475 222
21 3300028381 Ga0268264_10040067 Ga0268264_100400673 222
22 3300046506 Ga0495583_0063370 Ga0495583_0063370_655_1326 222
23 3300053724 Ga0500570_000006 Ga0500570_000006_50955_51626 222
24 3300005535 Ga0070684_100011428 Ga0070684_1000114285 223
25 3300005614 Ga0068856_100176276 Ga0068856_1001762762 223
26 3300006186 Ga0075369_10022314 Ga0075369_100223143 223
27 3300026078 Ga0207702_10141296 Ga0207702_101412962 223
28 3300028800 Ga0265338_10002488 Ga0265338_100024887 223
29 3300031730 Ga0307516_10000021 Ga0307516_10000021118 223
30 3300034820 Ga0373959_0000001 Ga0373959_0000001_154183_154854 223
31 3300045051 Ga0451576_0363458 Ga0451576_0363458_623_1411 223
32 3300050489 nmdc:mga03683_153566_c1 nmdc:mga03683_153566_c1_34_705 223
33 3300050516 nmdc:mga0sz30_13289_c1 nmdc:mga0sz30_13289_c1_2030_2716 223
34 3300005327 Ga0070658_10000717 Ga0070658_100007175 224
35 3300005327 Ga0070658_10021326 Ga0070658_100213263 224
36 3300005327 Ga0070658_10037592 Ga0070658_100375923 224
37 3300005329 Ga0070683_100000140 Ga0070683_10000014028 224
38 3300005330 Ga0070690_100023763 Ga0070690_1000237631 224
39 3300005335 Ga0070666_10170873 Ga0070666_101708732 224
40 3300005336 Ga0070680_100007242 Ga0070680_1000072426 224
41 3300005339 Ga0070660_100000035 Ga0070660_10000003584 224
42 3300005339 Ga0070660_100000837 Ga0070660_1000008379 224
43 3300005340 Ga0070689_100305802 Ga0070689_1003058022 224
44 3300005445 Ga0070708_100162564 Ga0070708_1001625643 224
45 3300005458 Ga0070681_10507558 Ga0070681_105075582 224
46 3300005530 Ga0070679_100006394 Ga0070679_1000063949 224
47 3300005535 Ga0070684_100000544 Ga0070684_10000054427 224
48 3300005544 Ga0070686_100001746 Ga0070686_10000174611 224
49 3300005563 Ga0068855_100045161 Ga0068855_1000451614 224
50 3300005563 Ga0068855_100226471 Ga0068855_1002264712 224
51 3300005577 Ga0068857_100049490 Ga0068857_1000494903 224
52 3300005843 Ga0068860_100261076 Ga0068860_1002610762 224
53 3300006931 Ga0097620_101117827 Ga0097620_1011178271 224
54 3300009093 Ga0105240_10029625 Ga0105240_100296255 224
55 3300013296 Ga0157374_10426095 Ga0157374_104260952 224
56 3300013307 Ga0157372_10005893 Ga0157372_100058936 224
57 3300013307 Ga0157372_10018029 Ga0157372_100180297 224
58 3300025909 Ga0207705_10000280 Ga0207705_1000028052 224
59 3300025917 Ga0207660_10001981 Ga0207660_1000198111 224
60 3300025919 Ga0207657_10002071 Ga0207657_100020714 224
61 3300025921 Ga0207652_10000657 Ga0207652_100006573 224
62 3300025925 Ga0207650_10025802 Ga0207650_100258027 224
63 3300025944 Ga0207661_10000021 Ga0207661_1000002163 224
64 3300025949 Ga0207667_10048179 Ga0207667_100481793 224
65 3300025949 Ga0207667_10136379 Ga0207667_101363792 224
66 3300026078 Ga0207702_10000001 Ga0207702_10000001955 224
67 3300026078 Ga0207702_10101113 Ga0207702_101011133 224
68 3300026078 Ga0207702_10255264 Ga0207702_102552641 224
69 3300026116 Ga0207674_10664072 Ga0207674_106640721 224
70 3300028556 Ga0265337_1002818 Ga0265337_10028184 224
71 3300028556 Ga0265337_1003164 Ga0265337_10031645 224
72 3300028558 Ga0265326_10004394 Ga0265326_100043942 224
73 3300028573 Ga0265334_10014732 Ga0265334_100147322 224
74 3300028577 Ga0265318_10042012 Ga0265318_100420122 224
75 3300028654 Ga0265322_10012103 Ga0265322_100121032 224
76 3300028666 Ga0265336_10005752 Ga0265336_100057524 224
77 3300028800 Ga0265338_10001381 Ga0265338_1000138110 224
78 3300028800 Ga0265338_10013628 Ga0265338_100136287 224
79 3300028800 Ga0265338_10017314 Ga0265338_100173145 224
80 3300031249 Ga0265339_10026410 Ga0265339_100264103 224
81 3300031251 Ga0265327_10025447 Ga0265327_100254473 224
82 3300031344 Ga0265316_10213759 Ga0265316_102137592 224
83 3300037418 Ga0395900_0362647 Ga0395900_0362647_455_1132 224
84 3300044673 Ga0453683_0412512 Ga0453683_0412512_95_772 224
85 3300044712 Ga0453684_0000667 Ga0453684_0000667_30921_31604 224
86 3300044712 Ga0453684_0105334 Ga0453684_0105334_2232_2909 224
87 3300044712 Ga0453684_0157857 Ga0453684_0157857_1060_1743 224
88 3300045051 Ga0451576_0092004 Ga0451576_0092004_2045_2728 224
89 3300045051 Ga0451576_0179174 Ga0451576_0179174_566_1249 224
90 3300049568 Ga0501031_0000276 Ga0501031_0000276_16930_17613 224
91 3300049569 Ga0501032_0006237 Ga0501032_0006237_7497_8180 224
92 3300049571 Ga0501034_0019372 Ga0501034_0019372_3599_4276 224
93 3300049571 Ga0501034_0021503 Ga0501034_0021503_4189_4872 224
94 3300049572 Ga0501036_0017950 Ga0501036_0017950_3011_3694 224
95 3300049573 Ga0501037_0000113 Ga0501037_0000113_34218_34901 224
96 3300049574 Ga0501038_0010102 Ga0501038_0010102_5999_6682 224
97 3300049575 Ga0501039_0340196 Ga0501039_0340196_223_906 224
98 3300049576 Ga0501040_0313765 Ga0501040_0313765_263_946 224
99 3300049578 Ga0501042_0046477 Ga0501042_0046477_1956_2639 224
100 3300049579 Ga0501043_0000205 Ga0501043_0000205_21233_21916 224
101 3300049580 Ga0501046_0000038 Ga0501046_0000038_45526_46209 224
102 3300049581 Ga0501047_0000355 Ga0501047_0000355_8477_9160 224
103 3300049582 Ga0501048_0006697 Ga0501048_0006697_1921_2604 224
104 3300049585 Ga0501069_0317035 Ga0501069_0317035_58_735 224
105 3300049586 Ga0501070_0037860 Ga0501070_0037860_2538_3221 224
106 3300049742 Ga0501080_0393587 Ga0501080_0393587_79_756 224
107 3300049822 Ga0501035_0000768 Ga0501035_0000768_33160_33843 224
108 3300049823 Ga0501044_0008259 Ga0501044_0008259_3104_3787 224
109 3300050492 nmdc:mga0yw44_206005_c1 nmdc:mga0yw44_206005_c1_89_766 224
110 3300053139 Ga0500568_0088071 Ga0500568_0088071_396_1070 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

42

152

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

183

261

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9707 1 118
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9686 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9674 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9668 1 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9649 1 118
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9831 1 77 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.977 1 77 3.40.50.2300
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9767 126 223 1.10.10.10
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9746 1 83 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.973 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4R6QUC2-F1-model_v4 DNA-binding response OmpR family regulator 0.8489 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4R6QUC2-F1-model_v4 DNA-binding response OmpR family regulator 0.8284 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3N5MU89-F1-model_v4 DNA-binding response regulator 0.8161 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3N5MU89-F1-model_v4 DNA-binding response regulator 0.8097 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C2Y007-F1-model_v4 deleted 0.8078 1 224

Feature Viewer

pLDDT pTM Quality
85.98 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map